DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cut-6

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_499400.2 Gene:cut-6 / 176520 WormBaseID:WBGene00000853 Length:572 Species:Caenorhabditis elegans


Alignment Length:285 Identity:67/285 - (23%)
Similarity:115/285 - (40%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IAGNELWPMERPDGMPNIVSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPP----- 90
            :|.:..|.|.:.:..|.  :.|::||.|.:.|..:...||||.|.....:.|..|...|.     
 Worm   212 LADSLTWSMCKTEFRPG--TPEIICGPDRIGVKASTKQPFEGNVFVMDHYHDEECRAGPEKFPDS 274

  Fly    91 -STGKTFFSFRISYSRCGTK--PDLN--GQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKT 150
             |.|.|     :.:|.|...  ..||  |.|.|.::|..:....:...|:..:::|     :...
 Worm   275 RSIGLT-----VPFSACNVHRYRSLNPKGIFVEVSIVFMFHSLFMTKTDQTVKVQC-----FYME 329

  Fly   151 ASKPPMVIADLDVIQLDFRGDNV----DCWMEIQHGKGPWAP--PVSGIVPLGSTL-----TLVV 204
            |.|...|...:.:|...|| :.:    .|...::.|    ||  |:.....||.::     .:.|
 Worm   330 ADKHVTVPLSVSMITTVFR-EQIYQMPQCAYTLRKG----APDGPIVRFATLGESVYHRWECIEV 389

  Fly   205 AINDYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAPD-ERATVITYAFFHA 268
            ...| :..|.|.|.||...:|.|..:::.|..||.|...::|      .|| :.:..:....:|.
 Worm   390 EGAD-KDTFGMLVHSCYVDNGYGDRVDILDSNGCGLDAVLLS------TPDYDTSLRLATKPYHV 447

  Fly   269 FKFPDALSVHIKCKVEICRH---GC 290
            ||:.|...:..:|::.:|..   ||
 Worm   448 FKYADRPVLQFQCQITLCLKYDGGC 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 59/252 (23%)
Zona_pellucida <194..287 CDD:278526 23/98 (23%)
cut-6NP_499400.2 VWA 48..208 CDD:395045
ZP 233..480 CDD:214579 62/262 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.