DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and mua-3

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001022674.1 Gene:mua-3 / 176430 WormBaseID:WBGene00003482 Length:3767 Species:Caenorhabditis elegans


Alignment Length:289 Identity:62/289 - (21%)
Similarity:90/289 - (31%) Gaps:78/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PWAPPVSGIVPLGSTLTL----VVAINDYRGEFDMRVKSCVASDGSG-----HVINLSDEFGC-- 238
            |.|...||::..|:|..:    |..::.|..|..:|:......|..|     .:...|.|:..  
 Worm  3500 PRAKLKSGMMASGNTAEVRNMEVARLDQYLDENAVRIPRAHLVDAHGDTSFDSLSEASSEYTIKE 3564

  Fly   239 -----VLRPKMISRFLKARAPDERA-TVITYAFFHAFKFPDALSVHIKCKVEICRHGCLDHCQNT 297
                 |:..............||:. |::|          ...:||.:              ..|
 Worm  3565 EIERKVITDVTTKEIKTTTTTDEQGNTIVT----------TTEAVHPR--------------DTT 3605

  Fly   298 GVGGGGGGSGESLGLGLGLGLTNANERKDVHMSDALGSSSNDLLRDLALPPGGQHGMGMGMGPD- 361
            .|.|||....||.......|     ||.....|....|.|..:.:.::     ||....|.... 
 Worm  3606 IVHGGGYTQNESSSSSFSGG-----ERAYQSQSQQQQSMSQGMSQSMS-----QHATSAGYSSSG 3660

  Fly   362 -----HDIFYEDIIHDHKQTLGGG----------GMPAGGD-YGHEKSVNLQPRPVHEE-QEEAD 409
                 |:..|..|.|..::..||.          ||.|... |.|..|.|   |.|.|. .||.|
 Worm  3661 MESSAHNSGYASIRHTGERERGGSEEEFSIGRARGMAAASSGYQHSSSEN---REVEEYCSEEED 3722

  Fly   410 LSDLFGD------EDLADLDMEGGEGERY 432
            :....||      ::.:......||.||:
 Worm  3723 VEHSVGDKRTIVTKNHSYEPFVNGESERF 3751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 21/117 (18%)
Zona_pellucida <194..287 CDD:278526 17/109 (16%)
mua-3NP_001022674.1 LDLa 32..60 CDD:238060
LDLa 131..164 CDD:238060
EGF_3 766..795 CDD:289699
vWA_collagen_alphaI-XII-like 1229..1398 CDD:238759
EGF_3 1662..1691 CDD:289699
EGF_CA 1709..1755 CDD:214542
EGF_CA 1964..1997 CDD:214542
SEA 2873..2998 CDD:214554
SEA 3049..3173 CDD:214554
EGF_CA 3328..3364 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.