DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cut-1

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_496410.1 Gene:cut-1 / 174720 WormBaseID:WBGene00000851 Length:424 Species:Caenorhabditis elegans


Alignment Length:319 Identity:73/319 - (22%)
Similarity:121/319 - (37%) Gaps:54/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CIFILHLMFSLVIAGNELWPMERPDGMPNIVSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDP 83
            |:..|.|..|.:...|.:      :|.|     ||.||.:.:.|:....:||||.|..||.:...
 Worm     8 CLAALVLSASAIPVDNNV------EGEP-----EVECGPNSITVNFNTRNPFEGHVYVKGLYDQA 61

  Fly    84 RCVYVPPSTGKTFFSFRISYSRCGT--KPDLN--GQFYENTVVVQYDKDLLEVWDEAKRLRCEWF 144
            .|  .....|:......:.:..|.|  ...||  |.|...|||:.:....:...|.|.|::| ::
 Worm    62 GC--RSDEGGRQVAGIELPFDSCNTARTRSLNPKGVFVSTTVVISFHPQFVTKVDRAYRIQC-FY 123

  Fly   145 NDYEKTASKPPMVIADLDVIQLDFRGDNVD---CWMEIQHGKGPWAPPVSGIVPLGSTL----TL 202
            .:.:||.| ..:.::||...   |:...|.   |..||..| ||...|:. ...:|..:    |.
 Worm   124 MESDKTVS-TQIEVSDLTTA---FQTQVVPMPVCKYEILDG-GPSGQPIQ-FATIGQQVYHKWTC 182

  Fly   203 VVAINDYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFH 267
            .....|   .|...|.||...||:|..:.:.:|.||.|...:::..      :....::.....|
 Worm   183 DSETTD---TFCAVVHSCTVDDGNGDTVQILNEEGCALDKFLLNNL------EYPTDLMAGQEAH 238

  Fly   268 AFKFPDALSVHIKCKV---------EICRHGCLD-----HCQNTGVGGGGGGSGESLGL 312
            .:|:.|...:..:|::         |..|..|.:     ..:..|.||....:....|:
 Worm   239 VYKYADRSQLFYQCQISITIKDPGSECARPTCSEPQGFGAVKQAGAGGAHAAAAPQAGV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 58/250 (23%)
Zona_pellucida <194..287 CDD:278526 19/105 (18%)
cut-1NP_496410.1 ZP 32..271 CDD:214579 59/256 (23%)
Zona_pellucida <171..271 CDD:278526 20/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.