DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-9

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_496293.2 Gene:cutl-9 / 174640 WormBaseID:WBGene00010893 Length:562 Species:Caenorhabditis elegans


Alignment Length:265 Identity:58/265 - (21%)
Similarity:81/265 - (30%) Gaps:98/265 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SDPRCVYVPPST--------------GKTFFSFRISYSRCGTKPD--LN--GQFYENTVVVQYDK 127
            |.|.|   ||.|              ........:..:.|.||.|  ||  ........||.:..
 Worm   232 SSPDC---PPLTTCAPCACEERRTRRATNSIRLEVPLNSCNTKRDRKLNPPSVVVSLIAVVSFHD 293

  Fly   128 DLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRGDNVDCWMEIQHGKGPWAPPVSG 192
            ..:...|:|..::|. :.:.|||.|      .||||...|.:..|           |...||...
 Worm   294 SFITKLDKAYHIQCA-YAEAEKTVS------TDLDVNMTDEQEIN-----------GTVEPPSCD 340

  Fly   193 IVPLGSTLTLVVAINDYRG------------------------EFDMRVKSCVASDGSGHVINLS 233
            .:           |:|..|                        :..|.|..|...||:|....:.
 Worm   341 YL-----------ISDQNGNSVQNSLVGELVRHQWVCKGGLTNKLKMLVHQCYVKDGAGQQFEVI 394

  Fly   234 DEFGCVLRPKMISRFLKARAPDERATVITYA--------FFHAFKFPDALSVHIKCKVEICR--- 287
            |:.||.|...|:      :.|       ||:        ..:.|||||..:|..:|.:..|.   
 Worm   395 DQHGCTLDQLML------QTP-------TYSEDGMSAQVDAYIFKFPDRSTVDFRCTITFCSVDD 446

  Fly   288 HGCLD 292
            ..|||
 Worm   447 AECLD 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 54/254 (21%)
Zona_pellucida <194..287 CDD:278526 24/124 (19%)
cutl-9NP_496293.2 ZP 244..460 CDD:214579 52/250 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.