DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-16

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_495296.2 Gene:cutl-16 / 174065 WormBaseID:WBGene00019426 Length:488 Species:Caenorhabditis elegans


Alignment Length:280 Identity:71/280 - (25%)
Similarity:108/280 - (38%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSCIFILHLMFSLVIAGNELWPMERPDGMPNIVS--LEVMCGKDHMDVHLTFSHPFEGIVSSKGQ 79
            :|..|:| ||.:|.   |...|:...|   |.:|  .||.|....|.:.:.........|..||.
 Worm     2 TSIDFLL-LMLALF---NSAQPIVEFD---NHISDEPEVSCHSGFMSLKVNTEKSPPSHVFVKGH 59

  Fly    80 HSDPRCVYVPPSTGKTFFSFRISYSRCGT----KPDLNGQFYENTVVVQYDKDLLEVWDEAKRLR 140
            .....|.:  .:|....|.|    |:|..    :.:..|..|..|||||.........|.|.:||
 Worm    60 FRKDGCSF--SNTANATFEF----SKCDVMRQREANPKGMAYTATVVVQLHPLFTTKVDRAYKLR 118

  Fly   141 CEWFNDYEKTASKPPMVIADLDVIQLDFRGDNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVA 205
            | ::.:.|| |....:.::|...:||:.......|...| |.:.| ..|::....||..|..|..
 Worm   119 C-FYKEAEK-AVGAEVSVSDPTPVQLEDESPQPVCSYTI-HKESP-NGPIAKFAQLGDVLYHVWE 179

  Fly   206 INDYRGEFDMRVKSCVASDGSGHVINLSDEFGC----VLRPKMISRFLKARAPDERATVITYAFF 266
            ...  ..:.|.|.:|....|..:...:..|.||    .:.|.:|....:.:|         :...
 Worm   180 CPS--EAYQMEVYNCDVVGGEEYSKKVIGENGCSEDIYIMPNLIYNENRTKA---------FVNS 233

  Fly   267 HAFKFPDALSVHIKCKVEIC 286
            :||.|||..:|.|.||:.:|
 Worm   234 NAFNFPDQNNVRISCKISVC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 57/238 (24%)
Zona_pellucida <194..287 CDD:278526 24/97 (25%)
cutl-16NP_495296.2 ZP 35..268 CDD:214579 58/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.