DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and Matn1

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_034899.2 Gene:Matn1 / 17180 MGIID:106591 Length:500 Species:Mus musculus


Alignment Length:172 Identity:39/172 - (22%)
Similarity:58/172 - (33%) Gaps:72/172 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 CGTKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRG 170
            |.|:|                .||:.|.|.::.:|..   ::||.......||..|||       
Mouse    39 CRTRP----------------TDLVFVVDSSRSVRPV---EFEKVKVFLSQVIESLDV------- 77

  Fly   171 DNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAINDYRGEFDMRVKSCVAS----------DG 225
                         ||.|..| |:|...||:         :.||.:|.....||          ..
Mouse    78 -------------GPNATRV-GLVNYASTV---------KPEFPLRAHGSKASLLQAVRRIQPLS 119

  Fly   226 SGHVINLSDEFGCVLRPKMISRFL------KARAPDERATVI 261
            :|.:..|:.:|.       |::.|      :||:||....||
Mouse   120 TGTMTGLALQFA-------ITKALSDAEGGRARSPDISKVVI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 39/172 (23%)
Zona_pellucida <194..287 CDD:278526 19/84 (23%)
Matn1NP_034899.2 vWA_Matrilin 42..265 CDD:238752 37/169 (22%)
vWFA 276..499 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.