DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-20

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_490798.1 Gene:cutl-20 / 171678 WormBaseID:WBGene00018787 Length:360 Species:Caenorhabditis elegans


Alignment Length:292 Identity:69/292 - (23%)
Similarity:117/292 - (40%) Gaps:60/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILH-LMFSLVIAGNELWPMERPDGMPNIVSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRC 85
            ||| :::|:|:.   |.|:.|...   ||...:.|.|....:.:.|...|.|.:.|:..|  |:|
 Worm     2 ILHWIIWSVVVV---LPPLIRSVA---IVDTSIACDKTDFLLKIKFDENFRGTIQSRAGH--PKC 58

  Fly    86 VYVPPS-TGKTFFSFRISYSRCGTKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRC-------- 141
            :|...: ...|.:..:|..:.|.||.:..|.......||..:.:.....|:...|.|        
 Worm    59 IYANGTLQSDTKYQLKIPLTGCSTKENGEGNLENEIEVVMANNEFNAETDKRFLLTCIPAAPVPK 123

  Fly   142 ----------EWFNDYEKTASKPPMVIADLDVIQLDFR-----GDNVDCWMEIQHGKGPWAPPVS 191
                      ...|....|||.    ::|...:  |:|     ||::|. .::|.       |::
 Worm   124 ESQVTVSFGGITINSDATTASS----LSDNKTV--DYRVRVLDGDSLDS-KQLQR-------PLA 174

  Fly   192 GIVPLGSTLTLVVAINDYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRP--KMISRFLKARAP 254
                :|..:|..|.::|   :.:.|:..|.|:||... :.|||..||.|:.  ::...|...|  
 Worm   175 ----VGDRVTYTVEMSD---DQNGRIGRCWANDGISE-LPLSDSHGCSLQTSGEVWGDFEVTR-- 229

  Fly   255 DERATVITYAFFHAFKFPDALSVHIKCKVEIC 286
             .....|.|....|:.||.:..|:|.|.:.:|
 Worm   230 -RNGKTIFYNHIKAWAFPTSNEVNIFCNLHVC 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 58/256 (23%)
Zona_pellucida <194..287 CDD:278526 26/95 (27%)
cutl-20NP_490798.1 Zona_pellucida 30..268 CDD:365872 59/258 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14780
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46560
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.