DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and COL6A2

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001840.3 Gene:COL6A2 / 1292 HGNCID:2212 Length:1019 Species:Homo sapiens


Alignment Length:221 Identity:55/221 - (24%)
Similarity:69/221 - (31%) Gaps:65/221 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GCLDHCQNTGVGG--GGGGSGESLGLGLGLGLTNANERK----DVHMSDALGSSSNDLLRDLALP 347
            ||.....|.|..|  |..||....|...|.|......|:    ::....:.|...|      :..
Human   343 GCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGN------SGA 401

  Fly   348 PG--GQHGMGMGMGPDHDIFYEDIIHDHKQTLGGGGMPA-GGDYGHEKSVNLQPRPVHEEQEEAD 409
            ||  |..|...|.||                .|..|.|. .||.|.:.|    |.....:.|:.|
Human   402 PGSPGVKGAKGGPGP----------------RGPKGEPGRRGDPGTKGS----PGSDGPKGEKGD 446

  Fly   410 LSDLFGDEDLA-DLDMEGGEGERYLGLKKSGKFPHGPRQLEAQKRMGVP----------MAGPRS 463
            ... .|...|| ::..:|.:|:|  ||..    |.||     |..:|.|          .|||| 
Human   447 PGP-EGPRGLAGEVGNKGAKGDR--GLPG----PRGP-----QGALGEPGKQGSRGDPGDAGPR- 498

  Fly   464 LEPHGHGDEDVPRPVYRPQAEALKQP 489
                  ||...|.|...|.......|
Human   499 ------GDSGQPGPKGDPGRPGFSYP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579
Zona_pellucida <194..287 CDD:278526
COL6A2NP_001840.3 Nonhelical region 21..256
vWA_collagen_alpha_1-VI-type 43..231 CDD:238757
Triple-helical region 257..590 55/221 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..588 55/221 (25%)
Collagen 259..316 CDD:189968
Collagen 337..406 CDD:189968 16/68 (24%)
Cell attachment site. /evidence=ECO:0000255 366..368 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 426..428 0/1 (0%)
Collagen 439..498 CDD:189968 18/70 (26%)
Collagen 481..>526 CDD:189968 12/45 (27%)
Cell attachment site. /evidence=ECO:0000255 489..491 0/1 (0%)
Cell attachment site. /evidence=ECO:0000255 498..500 1/8 (13%)
Cell attachment site. /evidence=ECO:0000255 539..541
Nonhelical region 591..1019
vWA_collagen_alpha_1-VI-type 612..803 CDD:238757
VWA 833..1007 CDD:306576
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.