DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and AgaP_AGAP001445

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_321684.4 Gene:AgaP_AGAP001445 / 1281732 VectorBaseID:AGAP001445 Length:220 Species:Anopheles gambiae


Alignment Length:96 Identity:28/96 - (29%)
Similarity:50/96 - (52%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LEVMCGKDHMDVHLTFSHPFEGIVSSKGQH---SDPRCVYVPPSTGKTFFSFRISYSRCGTKPDL 112
            :.:.||.|.|.:.|.....|:|::.::|.:   ::| |...|...|:| ...:.:..:|.|..  
Mosquito    23 VNLRCGADSMRIELKTEEDFQGVMYTRGSYYKQTEP-CFVKPERAGRT-LEMKFNLDQCQTVN-- 83

  Fly   113 NGQFYENTVVVQYDKDLLEVWDEAKRLRCEW 143
            ||:.|.|.||||:|.|::...|.|..:.|::
Mosquito    84 NGEVYSNIVVVQHDPDIVTPGDAAFAVECDF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 28/92 (30%)
Zona_pellucida <194..287 CDD:278526
AgaP_AGAP001445XP_321684.4 ZP 26..>145 CDD:214579 28/93 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.