DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and AgaP_AGAP010024

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_319172.4 Gene:AgaP_AGAP010024 / 1279452 VectorBaseID:AGAP010024 Length:3202 Species:Anopheles gambiae


Alignment Length:297 Identity:66/297 - (22%)
Similarity:109/297 - (36%) Gaps:63/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PNIVSLEVMCGKDHMDVHLTFSHP-FEGIVSSKGQHSDPRCVYVPPSTGKTFFS----FRISYSR 105
            |.:|   |.|..|.:.|.:..:.. |.|::..||...|..|..|....|.|..:    |::.:..
Mosquito  2803 PEMV---VTCQADGVQVVIDLAESNFNGVLYVKGHSKDEECRRVVNLAGDTSSARTQIFKVHFGS 2864

  Fly   106 CGTKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEW----------FNDYEKTA------SKP 154
            ||. ..:|| .....:|:|....|:....:|..::|.:          ||....|.      :.|
Mosquito  2865 CGL-IHVNG-IASFVLVIQKHPKLVTYKAQAYHIKCVYQTGEQNVTLGFNVQMLTTAGTIANTGP 2927

  Fly   155 PMVIADLDVIQLDFRGDNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAIND---YRGEFDMR 216
            |...| :.::.  |.|:.::.                  ..:|..|.|.|.:..   |.|    .
Mosquito  2928 PPTCA-MRIVA--FNGEEINS------------------AEIGDNLRLQVEVQPATIYGG----F 2967

  Fly   217 VKSCVASDGSGHVIN---LSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALSVH 278
            .:||||......|.|   ::||.||...|.:...:     .....|....|.|:|||||.:.::.
Mosquito  2968 ARSCVAKTMEESVENEYIVTDEDGCATDPSIFGDW-----EYNAETNSLLASFNAFKFPSSDNIR 3027

  Fly   279 IKCKVEICRHGCLD-HCQNTGVGGGGGGSGESLGLGL 314
            .:|.:.:|...|.. :|......|......|:||:.:
Mosquito  3028 FQCNIRVCFGKCQPVNCHGANAYGKRRRRREALGIDM 3064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 56/257 (22%)
Zona_pellucida <194..287 CDD:278526 26/98 (27%)
AgaP_AGAP010024XP_319172.4 ZP 2808..3044 CDD:214579 58/267 (22%)
Zona_pellucida <2948..3035 CDD:278526 26/95 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.