DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and AgaP_AGAP002316

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_312656.5 Gene:AgaP_AGAP002316 / 1273654 VectorBaseID:AGAP002316 Length:795 Species:Anopheles gambiae


Alignment Length:272 Identity:70/272 - (25%)
Similarity:104/272 - (38%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRC-VYVPPSTGKTFFSFRISYS--RCGTKP 110
            ||:|  |....|...:..|..|:|.|.:||  |...| |.|..|..   |..|:.|.  .|..:.
Mosquito   374 VSIE--CRAGDMIAKIRTSKLFDGKVYAKG--SPNSCSVDVKSSLE---FELRMGYQDIDCNVRQ 431

  Fly   111 DLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRGD---- 171
            :..|: |.|.||:|:...::...|....:.|: ::...||.|.      |:|   ||..||    
Mosquito   432 NGLGR-YLNDVVIQHHDTIVTSSDLGLAVTCQ-YDLTNKTVSN------DVD---LDVTGDIEPA 485

  Fly   172 ----------NVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAINDYRGEFDMRVKSCVASDG- 225
                      ||...:..:.|.     .:.....:|..|.|...|.|.:..:::.|:..||.|| 
Mosquito   486 LSEEVVVDSPNVVMKITTRDGS-----EMMRTAEVGDPLALRFEILDPQSPYEIFVRELVAMDGV 545

  Fly   226 SGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALSVHIKCKVEICRHGC 290
            ....|.|.|..||.....::....|:.:..:    |..:.|.|||||.:..|..:..|..|...|
Mosquito   546 DSSEITLIDARGCPTDHFIMGPIYKSASSGK----ILLSHFDAFKFPSSEMVQFRALVTPCMPTC 606

  Fly   291 LD-HCQNTGVGG 301
            .. .|.....||
Mosquito   607 EPVQCDQDDFGG 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 62/248 (25%)
Zona_pellucida <194..287 CDD:278526 25/93 (27%)
AgaP_AGAP002316XP_312656.5 PAN_1 115..193 CDD:278453
PAN_AP_HGF 200..281 CDD:238532
PAN_1 290..>352 CDD:278453
ZP 377..612 CDD:214579 65/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.