DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and AgaP_AGAP007051

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_308712.4 Gene:AgaP_AGAP007051 / 1270050 VectorBaseID:AGAP007051 Length:433 Species:Anopheles gambiae


Alignment Length:346 Identity:79/346 - (22%)
Similarity:131/346 - (37%) Gaps:87/346 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SLEVMCGKDHM-----DVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTFF-------SFRIS 102
            ::.:.|....|     |.....:..|.|:|..||...:..|:        |.:       .:::.
Mosquito    40 TVRIQCQSGSMLITIKDAPANLNGQFSGMVYPKGLAKNSTCL--------TEYHEQEGPLRYKLP 96

  Fly   103 YSRCGTKP----DLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFN--------DYEKTAS--K 153
            ...|.|.|    |...:|: ||:|:|....|:........:||.:.:        .|...|:  .
Mosquito    97 LKSCNTMPIETEDGGIEFF-NTIVLQPHLKLVTDLGRGYHVRCRYKSREAALKNVSYRHKAADDS 160

  Fly   154 PPMVIADLDVIQLDFR--GDNVD------------------------CWMEIQHGKGPWAPPVSG 192
            .|:.:...:....|.|  |.::|                        |.|:|..|:     .::.
Mosquito   161 RPLALTSAEGAGPDRREHGRSMDSGKDDRAVSGEDGQQQDAGKPMPGCHMKIFTGE-----KLAE 220

  Fly   193 IVPLGSTLTLVVAINDYRGEFDMRVKSCVASDGS--GHVINLSDEFGCVLRPKMISRFLKARAPD 255
            .|.:|..||||:.| |.:.|:.:.|..|:..||.  |....:||| ||.|..:::..| :..|..
Mosquito   221 NVKIGDPLTLVINI-DQQEEYGLHVTDCLVRDGLGWGEQKLISDE-GCPLDSEILGPF-EYTADR 282

  Fly   256 ERATVITYAFFHAFKFPDALSVHIKCKVEICR------H---GCLDHCQNTGVGGGGGGSGESLG 311
            .:|||.    |.|.|||...||:.:|.|::|.      |   .|.:..:.|.......|...::.
Mosquito   283 SKATVT----FPAHKFPYTSSVYYQCNVKLCALKDPDCHKTPTCTNKSRRTKRQTDEEGQPATIE 343

  Fly   312 LGLGLGLTNANERKDVHMSDA 332
            :..||   :.||..:|...||
Mosquito   344 VFSGL---HVNENAEVLSDDA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 67/284 (24%)
Zona_pellucida <194..287 CDD:278526 34/94 (36%)
AgaP_AGAP007051XP_308712.4 ZP 44..323 CDD:214579 69/299 (23%)
Zona_pellucida <221..323 CDD:278526 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.