DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hmgb3 and Dsp1

DIOPT Version :9

Sequence 1:NP_001004888.1 Gene:hmgb3 / 448228 XenbaseID:XB-GENE-1002014 Length:202 Species:Xenopus tropicalis
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:216 Identity:101/216 - (46%)
Similarity:141/216 - (65%) Gaps:31/216 - (14%)


- Green bases have known domain annotations that are detailed below.


 Frog     8 KPKGKMSAYAYFVQTCREEHKKKNPEIPVNFAEFSKKCSERWKTMSAKEKSKFDDLAKADKVRYD 72
            ||:|:|:||||||||||||||||:|:..|.|||||:||:||||||..|||.:|.::|:.||.||:
  Fly   182 KPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYE 246

 Frog    73 REMKDFGPVK-----KGKKK---KDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGE 129
            .||:::.|.|     :|||:   ||||||||..|.||.||::.|.|:|:.||...:||:||:||.
  Fly   247 AEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGR 311

 Frog   130 MWNNLNDGEKQPYNNKAAKLKEKYEKDVADYKSKGKFDCAKGAPKL-------ARKK-------- 179
            .|::::...||.|.:.|.:.|.:||:::.:||:.||.  |..||.:       |:|.        
  Fly   312 KWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKI--AMSAPSMQASMQAQAQKAALLAAAAQ 374

 Frog   180 ------EEDEDDDDEDEEEDE 194
                  ||..||||.|.::||
  Fly   375 QQHQQLEEQHDDDDGDGDDDE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hmgb3NP_001004888.1 HMG-box 13..78 CDD:381793 43/64 (67%)
HMG_box 93..160 CDD:366139 27/66 (41%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 46/69 (67%)
HMGB-UBF_HMG-box 275..339 CDD:238686 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5770
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3511
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 1 1.000 - - otm48181
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 1 1.000 - - X111
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.