DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment g and GBA2

DIOPT Version :10

Sequence 1:NP_524785.2 Gene:g / 44819 FlyBaseID:FBgn0001087 Length:1034 Species:Drosophila melanogaster
Sequence 2:XP_006716872.1 Gene:GBA2 / 57704 HGNCID:18986 Length:933 Species:Homo sapiens


Alignment Length:100 Identity:26/100 - (26%)
Similarity:40/100 - (40%) Gaps:30/100 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 RHGRLIAEQLLDVAIRVPVVRQFAVNEMTNLLDTFTVSAQSNSMYEVLYAAAWIVGEFAGELEDA 498
            |.|:.:.:|:|.:. |..|:|.:    ...|...|       :.|..||..||.|.:..|:    
Human   202 REGQTVYQQVLSLE-RPSVLRSW----NWGLCGYF-------AFYHALYPRAWTVYQLPGQ---- 250

  Fly   499 EKTLNILLRPR----LLPGHIQ------GVYVQNV 523
                |:.|..|    :||...|      ||:|.:|
Human   251 ----NVTLTCRQITPILPHDYQDSSLPVGVFVWDV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gNP_524785.2 Adaptin_N 33..578 CDD:396262 25/99 (25%)
AP3D1 687..840 CDD:461889
GBA2XP_006716872.1 Glyco_hydr_116N 166..461 CDD:463496 25/99 (25%)
DUF608 527..890 CDD:461391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.