DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment g and GBA2

DIOPT Version :9

Sequence 1:	NP_524785.2	Gene:	g / 44819	FlyBaseID:	FBgn0001087	Length:	1034	Species:	Drosophila melanogaster
Sequence 2:	XP_006716872.1	Gene:	GBA2 / 57704	HGNCID:	18986	Length:	933	Species:	Homo sapiens

Alignment Length:	100	Identity:	26/100 - (26%)
Similarity:	40/100 - (40%)	Gaps:	30/100 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   434 RHGRLIAEQLLDVAIRVPVVRQFAVNEMTNLLDTFTVSAQSNSMYEVLYAAAWIVGEFAGELEDA 498
            |.|:.:.:|:|.:. |..|:|.:    ...|...|       :.|..||..||.|.:..|:
Human   202 REGQTVYQQVLSLE-RPSVLRSW----NWGLCGYF-------AFYHALYPRAWTVYQLPGQ---- 250

  Fly   499 EKTLNILLRPR----LLPGHIQ------GVYVQNV 523
                |:.|..|    :||...|      ||:|.:|
Human   251 ----NVTLTCRQITPILPHDYQDSSLPVGVFVWDV 281

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
g	NP_524785.2	Adaptin_N	33..578	CDD:279882	25/99 (25%)
		HEAT repeat	152..173	CDD:293787
		HEAT repeat	185..213	CDD:293787
		Cnd1	<193..266	CDD:289487
		HEAT repeat	221..263	CDD:293787
		HEAT repeat	272..290	CDD:293787
		HEAT repeat	302..331	CDD:293787
		BLVR	687..840	CDD:283923
GBA2	XP_006716872.1	GBA2_N	166..461	CDD:289023	25/99 (25%)
		DUF608	527..890	CDD:282531
		GDE_C	<625..>753	CDD:283786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4354
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900