DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment g and AP2A1

DIOPT Version :9

Sequence 1:NP_524785.2 Gene:g / 44819 FlyBaseID:FBgn0001087 Length:1034 Species:Drosophila melanogaster
Sequence 2:XP_011524858.1 Gene:AP2A1 / 160 HGNCID:561 Length:994 Species:Homo sapiens


Alignment Length:773 Identity:189/773 - (24%)
Similarity:341/773 - (44%) Gaps:154/773 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KGNFF----ERMFDKNLTDLVRGIR-----NNKDNEAKYISTCIEEIKQELRQDNI---SVKCNA 59
            :|..|    ||.:|.:...:|..::     .:|:.|.|.|:..:..|:.:.:.|..   ..|...
Human    11 RGGCFTDLSERAWDLDEVVIVEVLKTCSEGKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKY 75

  Fly    60 VAKLTYIQMLGYDISWAGFNIIEVMSSSRFTCKRIGYLAASQCFHPDSELLMLTTNMIRKDLNSQ 124
            |.||.:|.:||:||.:.....:.::||:::|.|:||||..|...:.:|||:.|..|.|:.||.|:
Human    76 VCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASR 140

  Fly   125 NQYDAGVALSGLSCFISPDLSRDLANDIMTLM--SSTKPYLRMKAVLMMYKVFLRYPEALRPA-- 185
            |.....:||..::...|.::....|.||..::  ..:...::..|.|.:.:::...|: |.|.  
Human   141 NPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASPD-LVPMGE 204

  Fly   186 -FPKLKEKLEDPDPGVQSAAVNVICELARKNPKNY-----LPLAPIFFKLMTTSTN--------- 235
             ..::...|.|...||.:|||::|..|.:|||.::     |.::.:...:.:.||:         
Human   205 WTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSASTDLQDYTYYFV 269

  Fly   236 --NWMLIKIIKLFGALTPLEPRLGK-KLIEPLTNLI-------------HSTSAMSLLYECINTV 284
              .|:.:|:::|.....|.|....| :|:|.|..::             ||.:..::|:|.|:.:
Human   270 PAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKVQHSNAKNAILFETISLI 334

  Fly   285 IAVLISISSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTH--PKSVQAHKDLIL 347
            |..     ...||  ..::.|.| |...::..:.||:||.|.:|..:..:.  .::|:.|.|.::
Human   335 IHY-----DSEPN--LLVRACNQ-LGQFLQHRETNLRYLALESMCTLASSEFSHEAVKTHIDTVI 391

  Fly   348 ACL-DDKDESIRLRALDLLYGMVSKKNLMEIVKRLLGHMERAEGSAYRDELLYKVIEICAQSSYL 411
            ..| .::|.|:|.||.||||.|..:.|..:||..:|.::|.|: .|.|:|::.|| .|.|:.   
Human   392 NALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETAD-YAIREEIVLKV-AILAEK--- 451

  Fly   412 YVTNFEWYLTVLVELIQLEAGSRHGRLIAEQLLDVAIRVPVVRQFAVNEMTNLLDTFTVSAQSNS 476
            |..::.||:..::.||::.     |..::|::....:::          :||..|....:|:  :
Human   452 YAVDYSWYVDTILNLIRIA-----GDYVSEEVWYRVLQI----------VTNRDDVQGYAAK--T 499

  Fly   477 MYEVLYAAA----------WIVGEF----AGELEDAEKTLNILLRPRLLPGHIQGVYVQNVIKLF 527
            ::|.|.|.|          :|:|||    ||:...:......||..:.   |:..|..:      
Human   500 VFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKF---HLCSVATR------ 555

  Fly   528 ARLATTCLELQDL-PGLVTLCDHVL---DKLQHFNGSSDIEVQERANSACMLIEMLRNQLSTSTD 588
            |.|.:|.::..:| |........||   .:|:    ::|:|:|:||      :|.|......|||
Human   556 ALLLSTYIKFINLFPETKATIQGVLRAGSQLR----NADVELQQRA------VEYLTLSSVASTD 610

  Fly   589 AMAMDTTTEGGIPPLAIEIVQEMTLLFTGELIPVAPKAQRKVPLPDGLDLDEWINAPPPED---- 649
            .:|   |....:||..   .:|.::|         .|.:||.....|..||:....|...|    
Human   611 VLA---TVLEEMPPFP---ERESSIL---------AKLKRKKGPGAGSALDDGRRDPSSNDINGG 660

  Fly   650 ---AASSSSSEHDKDELF-------VSATQAGTGADG-------GEKRRQSLELTPEQ 690
               ..|:.|:.....:|.       .:|..|..||..       |...:.||..|||:
Human   661 MEPTPSTVSTPSPSADLLGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEE 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gNP_524785.2 Adaptin_N 33..578 CDD:279882 150/603 (25%)
HEAT repeat 152..173 CDD:293787 3/22 (14%)
HEAT repeat 185..213 CDD:293787 9/30 (30%)
Cnd1 <193..266 CDD:289487 24/89 (27%)
HEAT repeat 221..263 CDD:293787 9/53 (17%)
HEAT repeat 272..290 CDD:293787 4/17 (24%)
HEAT repeat 302..331 CDD:293787 9/28 (32%)
BLVR 687..840 CDD:283923 3/4 (75%)
AP2A1XP_011524858.1 Adaptin_N 46..608 CDD:279882 152/611 (25%)
HEAT repeat 349..372 CDD:293787 8/23 (35%)
HEAT repeat 386..415 CDD:293787 13/28 (46%)
HEAT repeat 425..451 CDD:293787 10/27 (37%)
Alpha_adaptinC2 772..875 CDD:197886
Alpha_adaptin_C 881..989 CDD:280460
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4354
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.