DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and TPK2

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_015121.1 Gene:TPK2 / 855898 SGDID:S000006124 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:124/302 - (41%)
Similarity:193/302 - (63%) Gaps:10/302 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   774 LTDLRVIATLGVGGFGRVELVQT--NGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQ 836
            |.|.:::.|||.|.||||.||::  ||   |.:|:|.:||.|:|:.:|.:|...|:.::......
Yeast    67 LHDFQIMRTLGTGSFGRVHLVRSVHNG---RYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHP 128

  Fly   837 FIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRD 901
            |:::::.||:|.:.::|:|:...||||:::||....|.:...:||.|.|:.|.:|||:.||||||
Yeast   129 FLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRD 193

  Fly   902 LKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMF 966
            |||||:||:..|::|:.||||||::||  .|||.||||:|:|||||..:.::.|.|:||||||::
Yeast   194 LKPENILLDRNGHIKITDFGFAKEVQT--VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIY 256

  Fly   967 ELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQ 1031
            |:|.|..||..:.||:||..||:|  .:.:|.....:..:|:.||...:...|:|..:.|..:|:
Yeast   257 EMLAGYTPFYDTTPMKTYEKILQG--KVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIK 319

  Fly  1032 KHKWFDGFYWWGLQNCTLEPPIKPAVKS-VVDTTNFDDYPPD 1072
            .|.||....|..|....:|.|.:|.:.| :.||:.||.||.:
Yeast   320 AHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736
CAP_ED 638..754 CDD:237999
S_TKc 778..1036 CDD:214567 108/259 (42%)
STKc_cGK 783..1043 CDD:270724 110/261 (42%)
TPK2NP_015121.1 STKc_PKA_like 69..358 CDD:270732 121/295 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.