DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and GORK

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_001332118.1 Gene:GORK / 833728 AraportID:AT5G37500 Length:842 Species:Arabidopsis thaliana


Alignment Length:434 Identity:82/434 - (18%)
Similarity:160/434 - (36%) Gaps:139/434 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 NLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSI-VYVMEDGRVEVSRE----------GKYLST 576
            ::....:||::..|..|.:   ::::....:|:| ..:::....|..|:          .|.|..
plant   276 DIHAVNLREMIFVMIYVSF---DMVLGAYLIGNITALIVKGSNTERFRDKMNDLISFMNRKKLGR 337

  Fly   577 LSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMR------TGLIRQAEYSDFLKS 635
            ...:::.|.:.:.|:...|                   .|:|::      ...|.|..|..::|.
plant   338 DLRSQITGHVRLQYDSHYT-------------------DTVMLQDIPASIRAKIAQLLYLPYIKK 383

  Fly   636 VPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRM 700
            ||:||..:.:.:.:|...|.|.::..|:.|..||...|..:.:.:|.:...:.:.|..||. :.:
plant   384 VPLFKGCSTEFINQIVIRLHEEYFLPGEVITEQGNVVDHLYFVCEGLLEALVTKTDGSEES-VTL 447

  Fly   701 LGKGDFFGEKALQGDDLRTANIICESADGVSCLV--------IDRETFNQLISNLDEIKHRYDDE 757
            ||....||:          .:|||..:...:..|        :|:::|    ||:.||   |..:
plant   448 LGPHTSFGD----------ISIICNISQPFTVRVCELCHLLRLDKQSF----SNILEI---YFHD 495

  Fly   758 G------AMERRKINEEFRDINLTD-------------LRVIATLGVGGFGRVE-LVQTNGDSSR 802
            |      .||.::.|:..:.:. :|             |:|.:....|.|.::: |:::..|.::
plant   496 GRTILNNIMEEKESNDRIKKLE-SDIVIHIGKQEAELALKVNSAAFQGDFYQLKSLIRSGADPNK 559

  Fly   803 ------------------SFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQ-------FIVK-- 840
                              ||      ||..:.....||:         |.|:       |:::  
plant   560 TDYDGRSPLVRLSLIDYLSF------KSLTLILFYIQHL---------AACRGYEDITLFLIQEG 609

  Fly   841 LFKTFKDKKYLYMLMESCLGGELWTI-----------LRDKGNF 873
            :....|||.....|.|:...|:...|           |.|.|||
plant   610 VDVNLKDKFGHTPLFEAVKAGQEGVIGLLVKEGASFNLEDSGNF 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736 16/120 (13%)
CAP_ED 520..629 CDD:237999 17/122 (14%)
Crp 632..>753 CDD:223736 31/128 (24%)
CAP_ED 638..754 CDD:237999 28/123 (23%)
S_TKc 778..1036 CDD:214567 26/135 (19%)
STKc_cGK 783..1043 CDD:270724 25/130 (19%)
GORKNP_001332118.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4624
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.