DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and PRKACB

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_891993.1 Gene:PRKACB / 5567 HGNCID:9381 Length:398 Species:Homo sapiens


Alignment Length:315 Identity:128/315 - (40%)
Similarity:197/315 - (62%) Gaps:14/315 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   764 KINEEF---------RDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQ 819
            |..|:|         .:..|.|.....|||.|.||||.||:... :.:.:|:|.:.|.::|:.:|
Human    69 KAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKA-TEQYYAMKILDKQKVVKLKQ 132

  Fly   820 QQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTAC 884
            .:|.::||.|:...|..|:|:|...|||...|||:||...|||:::.||..|.|.:...|||.|.
Human   133 IEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQ 197

  Fly   885 VVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILN 949
            :|..|:||||.::|||||||||||::.:||:::.||||||::: || |||.||||||:|||:||:
Human   198 IVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK-GR-TWTLCGTPEYLAPEIILS 260

  Fly   950 RGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRD 1014
            :|::.:.|:|:||||::|:..|.|||....|::.|..|:.|  .:.||.:.:.:..:|::.|.:.
Human   261 KGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQV 323

  Fly  1015 NPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDY 1069
            :..:|.|..:.|:|:|:.||||....|..:....:|.|..|..:...||:|||||
Human   324 DLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDY 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736
CAP_ED 638..754 CDD:237999
S_TKc 778..1036 CDD:214567 110/257 (43%)
STKc_cGK 783..1043 CDD:270724 112/259 (43%)
PRKACBNP_891993.1 STKc_PKA 89..378 CDD:271111 122/293 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.