DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and S6KL

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_524861.2 Gene:S6KL / 45970 FlyBaseID:FBgn0283473 Length:483 Species:Drosophila melanogaster


Alignment Length:283 Identity:86/283 - (30%)
Similarity:144/283 - (50%) Gaps:33/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 NEEFRDINLTDL-RVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEI 829
            |..|::.:..|| |:...:..|.||.|..|.:..|.|:.:|||.:|||:::|....:.|..|.:|
  Fly   147 NSHFKETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDNSVRQIKDEADI 211

  Fly   830 MGEANC---QFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDY 891
              :..|   .||||....::::..|::|.|....|||::.:.   :|.....|.|...:..|.|:
  Fly   212 --QKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKIT---HFSIDLVRLYIGEIALALDF 271

  Fly   892 LHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISA 956
            ||:..|||||.||||:||.|:.::||.|||.:|.|:.|..|.|.|||.:|:|||::....:..:.
  Fly   272 LHNAGIIYRDAKPENILLTEQFHIKLTDFGLSKWLKLGANTRTMCGTFKYMAPEILCGEPYGHAV 336

  Fly   957 DYWSLGVLMFELLTGTPP------------------FTGSDPMRTYNIILKGIDA------IEFP 997
            |:|:|||:..::||...|                  .:.:..:...|..|:..|.      .|..
  Fly   337 DWWALGVIACQMLTQKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEEV 401

  Fly   998 RNITRNASNLIKKLCRDNPAERL 1020
            :::|....::::||....|.:|:
  Fly   402 QHLTHEGRDVLRKLLTIEPRQRI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736
CAP_ED 638..754 CDD:237999
S_TKc 778..1036 CDD:214567 82/270 (30%)
STKc_cGK 783..1043 CDD:270724 81/265 (31%)
S6KLNP_524861.2 S_TKc 159..431 CDD:214567 82/271 (30%)
STKc_AGC 167..>354 CDD:270693 71/191 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.