DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and Pka-C2

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_733397.2 Gene:Pka-C2 / 43644 FlyBaseID:FBgn0000274 Length:354 Species:Drosophila melanogaster


Alignment Length:336 Identity:113/336 - (33%)
Similarity:187/336 - (55%) Gaps:17/336 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 RETFNQLISNLD-EIKHRYDDEGAMERRKINEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDS 800
            :|.:|.::.|:. |.:.|::.:         .:....||.:....|.||.|.||.|.||:.. ..
  Fly    13 KEDYNVILDNMSREFEERWNHQ---------TQSPYTNLENYITRAVLGNGSFGTVMLVREK-SG 67

  Fly   801 SRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWT 865
            ...:|.|.|.|..:|..:|..|:.:||.::..|...|::.|..:.|...|||:::....||||::
  Fly    68 KNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYLILPLVNGGELFS 132

  Fly   866 ILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGR 930
            ..|....|::...|||.|.|..|.:|:|..:::||||||||:||::|||:|:.||||.|::. ||
  Fly   133 YHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRGYIKITDFGFTKRVD-GR 196

  Fly   931 KTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFT--GSDPMRTYNIILKGIDA 993
             |.|.||||||:|||::..|.::.|.|:|:.|:|::|.:.|..||.  ..|.:..|:.|.  |..
  Fly   197 -TSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPFAIHNRDVILMYSKIC--ICD 258

  Fly   994 IEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVK 1058
            .:.|...|....:|::.|.:.:.::|||....|.|:::.|.||.|..|:|:.|..:..|.:|.:.
  Fly   259 YKMPSYFTSQLRSLVESLMQVDTSKRLGNSNDGSSDVKSHPWFQGVDWFGILNQEVTAPYQPTIS 323

  Fly  1059 SVVDTTNFDDY 1069
            ...|.:||:::
  Fly   324 GAEDLSNFENF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736 4/16 (25%)
CAP_ED 638..754 CDD:237999 4/17 (24%)
S_TKc 778..1036 CDD:214567 95/259 (37%)
STKc_cGK 783..1043 CDD:270724 98/261 (38%)
Pka-C2NP_733397.2 PKc_like 43..334 CDD:328722 106/295 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.