DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and CG12069

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster


Alignment Length:345 Identity:123/345 - (35%)
Similarity:187/345 - (54%) Gaps:28/345 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   733 LVID--RETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDINLTDLRVIATLGVGGFGRVELVQ 795
            |::|  ||.||:..:.                   |.......|.|..:.||||.|.||:|:||:
  Fly    20 LILDKLREDFNKKFAT-------------------NTPSPSTGLDDYEIKATLGSGSFGKVQLVR 65

  Fly   796 TNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLG 860
            .. :|...:|.||:.|.|||:|:|..|:||||.::........|.|..::||...||:::....|
  Fly    66 ER-ESGVYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGG 129

  Fly   861 GELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKK 925
            |||:|..|....|.:...|||.|.|..|.:|||..:::||||||||:::::.||:|:.|||||||
  Fly   130 GELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKK 194

  Fly   926 LQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFT--GSDPMRTYNIIL 988
            ::|  :|.|.||||||:.||:|.::.:..|.|:|:.|||:||.:.|..||:  ..|.|..||.|.
  Fly   195 VET--RTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKIC 257

  Fly   989 KGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPI 1053
            :.  ..:.|...:....:|:..|.:.:.::|.|....|..:|::|:||....|..|.|.|:..|.
  Fly   258 EA--DYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAPY 320

  Fly  1054 KPAVKSVVDTTNFDDYPPDP 1073
            .|.:.:..|.:|||.....|
  Fly   321 VPNISNPEDISNFDKVSDKP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736 6/21 (29%)
CAP_ED 638..754 CDD:237999 6/22 (27%)
S_TKc 778..1036 CDD:214567 101/259 (39%)
STKc_cGK 783..1043 CDD:270724 102/261 (39%)
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 116/302 (38%)
PKc_like 45..335 CDD:304357 113/294 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.