DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and CG14693

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_001262467.1 Gene:CG14693 / 41299 FlyBaseID:FBgn0037837 Length:586 Species:Drosophila melanogaster


Alignment Length:590 Identity:106/590 - (17%)
Similarity:202/590 - (34%) Gaps:185/590 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 MYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSR-------EGKYLSTLSGAKVLGELAILYNCQ 593
            :.||  .|..:||::.|....|:.:..|.|.:.:       ||..:..|....::|::.:|...:
  Fly   114 LMPV--DAGRIIIRQSDAPITVFFVLTGEVHMIKNEKNQKGEGVVMGFLGAGDMMGDVELLEGIK 176

  Fly   594 RTATITAITECNLWAIERQCFQTIM---------MRTGLIRQAEYSDFLKSVPIFKDLAEDTLIK 649
            ||.|..|.|.|.|..:....|..|:         .:...::..:|.|||..              
  Fly   177 RTHTFRAATYCELLVLFDYDFAPILGAY
MTKIWEEKKRALKALDYFDFLDD-------------- 227

  Fly   650 ISDVLEETHYQRGDYIVRQ------------GARGDTFFIISKGK--------VRVTIKQQDTQE 694
             ..::|...|.|    ::|            |:..:..|::| |:        ::||:|:     
  Fly   228 -DQIVEACRYGR----LKQFDPLDTIFCEDIGSMTNVHFVLS-GECLILQCLNIKVTMKR----- 281

  Fly   695 EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDD--- 756
                   ||..:....|.:||   .:.:..::.         |.||:...:|.|:.|....|   
  Fly   282 -------GKKVYDLLPASEGD---VSKMFRKAV---------RSTFSSQSTNEDQSKIDILDLVA 327

  Fly   757 ------EGAMERRKINEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQI- 814
                  .|..::..:|.:.|.::|.|:.          .|..::::....||....:.::||.: 
  Fly   328 STSSSSTGDAQKSALNRKMRKMDLRDIE----------KRCGMIKSPPQKSRFTWRRSIRKSTMS 382

  Fly   815 VETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTR 879
            |.:..:..::||             .:|:.|.:.......:||...|..:|.:..|.:|     |
  Fly   383 VFSHSENRLISE-------------DVFEDFWEMYENESDIESYSSGSDYTDVEFKQSF-----R 429

  Fly   880 FYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAP 944
            |..|.          .|....|....::              |:..|.:...:...| ||.:   
  Fly   430 FGPAL----------NNTAELDYDGSSI--------------FSSSLSSFSSSSGSC-TPTF--- 466

  Fly   945 EVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKG-IDAIEFPRNITRNASNLI 1008
                      .:.:..:|.:.|..:.|.     .:.|....|:.:. :..:..||..      |:
  Fly   467 ----------ESHFIDVGTITFGGIFGL-----GEKMENRVIMARSTVQCLILPRFF------LL 510

  Fly  1009 KKLCRDNPA----ERLGYQRGGISEIQKHKWFDGFY----WWGLQNCTLEPPIKPAVKSVVDTTN 1065
            :|  :.||.    .||.|.  |:....:...|..:.    |...:|..:...:||   |..|.|:
  Fly   511 EK--KQNPGNVWERRLLYV--GVMVPSREALFAHYRKACDWKKFKNDLISETLKP---SDNDITH 568

  Fly  1066 FDDYP 1070
            .:|.|
  Fly   569 IEDVP 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736 23/106 (22%)
CAP_ED 520..629 CDD:237999 23/108 (21%)
Crp 632..>753 CDD:223736 24/140 (17%)
CAP_ED 638..754 CDD:237999 22/135 (16%)
S_TKc 778..1036 CDD:214567 41/263 (16%)
STKc_cGK 783..1043 CDD:270724 43/269 (16%)
CG14693NP_001262467.1 Crp 90..>204 CDD:223736 23/91 (25%)
CAP_ED 97..204 CDD:237999 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.