DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and prkar2ab

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_998123.1 Gene:prkar2ab / 405894 ZFINID:ZDB-GENE-040426-2427 Length:422 Species:Danio rerio


Alignment Length:421 Identity:110/421 - (26%)
Similarity:176/421 - (41%) Gaps:84/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 TPSGTGGSATPSPVGLVDPNFIVSNYVAASPQEERFIQIIQAKELKIQEMQRALQFKDNEIAELK 420
            |.|.|..:::.|||...:.....|.:..:|.:||...:..:.:|.|.:|       :|.|     
Zfish    42 TRSSTRSASSRSPVTRGEAFDRDSAHTDSSVEEEEKPEEEEEEEEKPEE-------EDEE----- 94

  Fly   421 SHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALGISAEP 485
              .|.|...|.|.....:.|                                   .|.:.:.|||
Zfish    95 --EDDFPDDFTFKAPPPSKC-----------------------------------NRRVSVCAEP 122

  Fly   486 QSE----------SSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVK 540
            .:.          |.|.:.|      .|.:..|:.::.|.......|.|:..|:.|::|.|:.|.
Zfish   123 YNPDEDDDDGDEGSQLTVLH------QKTDEQRQRLQDACKHILLFKTLEEDQLAEVLDSMFEVL 181

  Fly   541 YPAKNLIIKEGDVGSIVYVMEDGRVEVSRE--------GKYLSTLSGAKVLGELAILYNCQRTAT 597
            ......||.:||.|...||:|.|..|:..:        |:|....|    .||||::||..|.||
Zfish   182 VKPGECIINQGDDGDNFYVIERGVYEIVIQQDGLQHSVGRYDHKGS----FGELALMYNTPRAAT 242

  Fly   598 ITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRG 662
            |.|:.|..|||::|..|..::::....::..|..|::.||:.|.|.....:||.|||....:..|
Zfish   243 IRALQEGALWALDRATFHRLIVKNNAKKRRMYESFIECVPLLKSLQLSERMKIVDVLGMRSFSDG 307

  Fly   663 DYIVRQGARGDTFFIISKGKVRVTIKQ-----QDTQEEKFIRMLGKGDFFGEKALQGDDLRTANI 722
            :.|::||...|.|:|:..|:||:.|:.     |..|||..:....:|.:|||.||.....|.|::
Zfish   308 ERIIQQGDSADCFYIVESGEVRIMIRSKTRACQLLQEEVEVARCSRGQYFGELALVTKRPRAASV 372

  Fly   723 ICESADGVSCLVIDRETFNQLISNLDEIKHR 753
            .  :.....|||||.:.|.:|:.:..:|..|
Zfish   373 Y--AVGDTRCLVIDVQAFERLLGSCKQILKR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374 11/46 (24%)
Crp 518..>627 CDD:223736 37/116 (32%)
CAP_ED 520..629 CDD:237999 37/116 (32%)
Crp 632..>753 CDD:223736 41/125 (33%)
CAP_ED 638..754 CDD:237999 39/121 (32%)
S_TKc 778..1036 CDD:214567
STKc_cGK 783..1043 CDD:270724
prkar2abNP_998123.1 DD_RII_PKA 5..41 CDD:213046
Crp 157..>266 CDD:223736 37/112 (33%)
CAP_ED 161..274 CDD:237999 37/116 (32%)
Crp 281..>392 CDD:223736 38/112 (34%)
CAP_ED 283..403 CDD:237999 39/121 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.