DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and Pka-R2

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_523671.1 Gene:Pka-R2 / 36041 FlyBaseID:FBgn0022382 Length:377 Species:Drosophila melanogaster


Alignment Length:286 Identity:94/286 - (32%)
Similarity:152/286 - (53%) Gaps:18/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 FPKYDKDERSR--ELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVM 560
            |||.| ::|:|  |.:|..:|    .::|:..|:.:::|.|:..|....:.||::||.|...||:
  Fly   105 FPKTD-EQRARLVESVKNVLL----FRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVI 164

  Fly   561 EDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIR 625
            |.|..:|....|:::|.:...:.||||:|||..|.||:.|.|...|||::||.|:.|::::...:
  Fly   165 ESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRK 229

  Fly   626 QAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ 690
            :..|.:.|.|||:.|.|.....:.::|.|....|..|:.|::||...|..:.|.:|.|.|.:.|.
  Fly   230 RKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQD 294

  Fly   691 DTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADG--VSCLVIDRETFNQLISN-LDEIKH 752
            |.:.|  |..||||.:|||.||.....|.|::.   |.|  |....:|.:.|.:|:.. :|.:|.
  Fly   295 DAEVE--ISQLGKGQYFGELALVTHRPRAASVY---ATGGVVKLAFLDVKAFERLLGPCMDIMKR 354

  Fly   753 RYDDEGAMERRKINEEFRDINLTDLR 778
            ..||   .|.:.:.......|:||.|
  Fly   355 NIDD---YESQLVKIFGSKNNITDTR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736 36/108 (33%)
CAP_ED 520..629 CDD:237999 36/108 (33%)
Crp 632..>753 CDD:223736 41/123 (33%)
CAP_ED 638..754 CDD:237999 37/118 (31%)
S_TKc 778..1036 CDD:214567 1/1 (100%)
STKc_cGK 783..1043 CDD:270724
Pka-R2NP_523671.1 DD_RII_PKA 11..49 CDD:213046
CAP_ED 124..233 CDD:237999 37/112 (33%)
CAP_ED 242..356 CDD:237999 37/118 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.