DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and kin-1

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_001368699.1 Gene:kin-1 / 3565407 WormBaseID:WBGene00002189 Length:579 Species:Caenorhabditis elegans


Alignment Length:392 Identity:136/392 - (34%)
Similarity:209/392 - (53%) Gaps:71/392 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 DEIKHRYD----------DEGAMERR---------------------------------KINEEF 769
            |||:.|||          ..|...||                                 |..|:|
 Worm   175 DEIQERYDMGNAASGGSSGGGGSARRGNGGGNNGSDYNNAMVFSNGRLAAAETIKEFLDKAREDF 239

  Fly   770 RD---------INLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMS 825
            :.         ..|.|...|.|||.|.||||.||: :..|...:|:|.:.|.::|:.:|.:|.::
 Worm   240 KQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVK-HKQSGNYYAMKILDKQKVVKLKQVEHTLN 303

  Fly   826 EKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFD 890
            ||.|:...:..|:|.:..:|||...|||::|...|||:::.||..|.|.:..:|||.|.:|.||:
 Worm   304 EKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFE 368

  Fly   891 YLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDIS 955
            ||||.::|||||||||||::..||:|:.||||||::: || |||.||||||:|||:||::|::.:
 Worm   369 YLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVK-GR-TWTLCGTPEYLAPEIILSKGYNKA 431

  Fly   956 ADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERL 1020
            .|:|:||||::|:..|.|||....|::.|..|:.|  .::||.:.:....:|:|.|.:.:..:|.
 Worm   432 VDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVKFPSHFSNELKDLLKNLLQVDLTKRY 494

  Fly  1021 GYQRGGISEIQKHKWFDGFYWWGLQNCTLEPP--------------IKPAVKSVVDTTNFDDYPP 1071
            |..:.|:::|:.||||....|..:....:.||              :.|.|....||.:|.:...
 Worm   495 GNLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQ 559

  Fly  1072 DP 1073
            :|
 Worm   560 EP 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736 3/4 (75%)
CAP_ED 638..754 CDD:237999 3/5 (60%)
S_TKc 778..1036 CDD:214567 111/257 (43%)
STKc_cGK 783..1043 CDD:270724 112/259 (43%)
kin-1NP_001368699.1 STKc_PKA 254..556 CDD:271111 122/306 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.