DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and Prkar2b

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_001351336.1 Gene:Prkar2b / 19088 MGIID:97760 Length:416 Species:Mus musculus


Alignment Length:403 Identity:108/403 - (26%)
Similarity:183/403 - (45%) Gaps:51/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 QIIQAKELKIQEMQRA--LQFKDNEIAELKSHLDKFQSVFPFSRGSAA-GCAG-TGGASGSGAGG 453
            :::|...:::...|.|  |:|.......|:...::        :|:|. |..| |.|.:|:.|||
Mouse    11 ELLQGFTVEVLRHQPADLLEFALQHFTRLQQENER--------KGAARFGHEGRTWGDAGAAAGG 67

  Fly   454 S-GGSGPGTATGATRKSGQNFQRQ-----------------RALGISAE---PQSESSLLLEHVS 497
            . ...|...|....|...:|.:.:                 |...:.||   |..|.......:.
Mouse    68 GIPSKGVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRII 132

  Fly   498 FPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMED 562
            .||.| |:|:|  ::.|..|....||||..|:.:::|.|:.........:|.:||.|...||::.
Mouse   133 HPKTD-DQRNR--LQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDR 194

  Fly   563 GR----VEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGL 623
            |.    |:....|:.:.........||||::||..|.|||||.:...||.::|..|:.|:::...
Mouse   195 GTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNA 259

  Fly   624 IRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIK 688
            .::..|..|::|:|..|.|.....:|:.||:....|..|:.|:.||...|:|||:..|:|::|:|
Mouse   260 KKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMK 324

  Fly   689 QQDTQEEK-----FIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLD 748
            ::...|.:     .|....:|.:|||.||..:..|.|:  ..:...|.||.:|.:.|.:|:....
Mouse   325 RKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAAS--AHAIGTVKCLAMDVQAFERLLGPCM 387

  Fly   749 EIKHR----YDDE 757
            ||..|    |:::
Mouse   388 EIMKRNIATYEEQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374 6/40 (15%)
Crp 518..>627 CDD:223736 33/112 (29%)
CAP_ED 520..629 CDD:237999 33/112 (29%)
Crp 632..>753 CDD:223736 39/125 (31%)
CAP_ED 638..754 CDD:237999 37/124 (30%)
S_TKc 778..1036 CDD:214567
STKc_cGK 783..1043 CDD:270724
Prkar2bNP_001351336.1 Dimerization and phosphorylation 1..151 33/150 (22%)
DD_RIIbeta_PKA 3..43 CDD:213051 6/31 (19%)
CAP_ED 152..265 CDD:237999 33/112 (29%)
CAP_ED 274..394 CDD:237999 37/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.