DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and Prkar2a

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_032950.1 Gene:Prkar2a / 19087 MGIID:108025 Length:402 Species:Mus musculus


Alignment Length:298 Identity:90/298 - (30%)
Similarity:150/298 - (50%) Gaps:22/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 RALGISAE---PQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYP 538
            |.:.:.||   |..|.......|..||.| ::|.|  ::.|..|....||||..|:.:::|.|:.
Mouse    94 RRVSVCAETFNPDEEEEDNDPRVVHPKTD-EQRCR--LQEACKDILLFKNLDQEQLSQVLDAMFE 155

  Fly   539 VKYPAKNLIIKEGDVGSIVYVMEDGRVEV----SREGKYLSTLSGAKVLGELAILYNCQRTATIT 599
            ........:|.:||.|...||:|.|..::    ..:.:.:.........||||::||..|.|||.
Mouse   156 KIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATII 220

  Fly   600 AITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDY 664
            |.:|.:||.::|..|:.|:::....::..:..|::|||:||.|.....:||.||:.|..|:.|:.
Mouse   221 ATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGER 285

  Fly   665 IVRQGARGDTFFIISKGKVRVTIKQQDT------QEEKFIRMLGKGDFFGEKALQGDDLRTANII 723
            |:.||.:.|:|:||..|:|.:.|:.:..      .:|..|....||.:|||.||..:..|.|:  
Mouse   286 IIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAAS-- 348

  Fly   724 CESADGVSCLVIDRETFNQLISNLDEIKHR----YDDE 757
            ..:...|.|||:|.:.|.:|:....:|..|    |:::
Mouse   349 AYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736 32/112 (29%)
CAP_ED 520..629 CDD:237999 32/112 (29%)
Crp 632..>753 CDD:223736 43/126 (34%)
CAP_ED 638..754 CDD:237999 40/125 (32%)
S_TKc 778..1036 CDD:214567
STKc_cGK 783..1043 CDD:270724
Prkar2aNP_032950.1 DD_RIIalpha_PKA 4..44 CDD:213050
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..84
CAP_ED 137..249 CDD:237999 32/111 (29%)
CAP_ED 259..380 CDD:237999 40/122 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.