DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and Prkaca

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_032880.1 Gene:Prkaca / 18747 MGIID:97592 Length:351 Species:Mus musculus


Alignment Length:290 Identity:126/290 - (43%)
Similarity:194/290 - (66%) Gaps:5/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 IATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKT 844
            |.|||.|.||||.||: :.:|...:|:|.:.|.::|:.:|.:|.::||.|:...|..|:|||..:
Mouse    47 IKTLGTGSFGRVMLVK-HKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFS 110

  Fly   845 FKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLL 909
            |||...|||:||...|||:::.||..|.|.:...|||.|.:|..|:||||.::|||||||||||:
Mouse   111 FKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLI 175

  Fly   910 NERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPP 974
            :::||:::.||||||::: || |||.||||||:|||:||::|::.:.|:|:||||::|:..|.||
Mouse   176 DQQGYIQVTDFGFAKRVK-GR-TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP 238

  Fly   975 FTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGF 1039
            |....|::.|..|:.|  .:.||.:.:.:..:|::.|.:.:..:|.|..:.|:::|:.||||...
Mouse   239 FFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT 301

  Fly  1040 YWWGLQNCTLEPPIKPAVKSVVDTTNFDDY 1069
            .|..:....:|.|..|..|...||:|||||
Mouse   302 DWIAIYQRKVEAPFIPKFKGPGDTSNFDDY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736
CAP_ED 638..754 CDD:237999
S_TKc 778..1036 CDD:214567 112/255 (44%)
STKc_cGK 783..1043 CDD:270724 113/259 (44%)
PrkacaNP_032880.1 STKc_PKA 42..331 CDD:271111 124/288 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.