DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment for and CNBD2

DIOPT Version :9

Sequence 1:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster
Sequence 2:XP_011526892.1 Gene:CNBD2 / 140894 HGNCID:16145 Length:617 Species:Homo sapiens


Alignment Length:505 Identity:96/505 - (19%)
Similarity:191/505 - (37%) Gaps:114/505 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   631 DFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQE- 694
            :.|:.:..:::.||...:.::.|:....:.|...|:::|.:|::|:.|..|.|.:| |.:|... 
Human   150 NILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAIT-KDEDGSSA 213

  Fly   695 --EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETF--NQLISNLD-EIKHRY 754
              :...::|.||..|||..:....:|.:.|:|  .:....||:|||.|  |:|...:. :.::|:
Human   214 FLDPHPKLLHKGSCFGEMDVLHASVRRSTIVC--MEETEFLVVDREDFFANKLDQEVQKDAQYRF 276

  Fly   755 DDEGAMERRKINEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQ 819
            :....||   :...:.|..|..|..:|.:....:|::        .|:.|.             :
Human   277 EFFRKME---LFASWSDEKLWQLVAMAKIERFSYGQL--------ISKDFG-------------E 317

  Fly   820 QQHIMSEKEIMGEANCQF--IVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYT 882
            ...||    .:.:.:|:.  ::.|..:...:::::..:|...|..|.|.|.:           |:
Human   318 SPFIM----FISKGSCEVLRLLDLGASPSYRRWIWQHLELIDGRPLKTHLSE-----------YS 367

  Fly   883 ACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVI 947
            .  :|.|.....::...:|.....|...::.: .|....|::|::|...|     .|:.:.|::.
Human   368 P--MERFKEFQIKSYPLQDFSSLKLPHLKKAW-GLQGTSFSRKIRTSGDT-----LPKMLGPKIQ 424

  Fly   948 LNRGHDISADYWSL--GVLMFELLTGT----------------PPFTGSDPMRTYNIILK--GID 992
            ......|.....::  |.|..|...|.                ..|.......|..:||.  |.:
Human   425 SRPAQSIKCAMINIKPGELPKEAAVGAYVKVHTVEQGEILGLHQAFLPEGECDTRPLILMSLGNE 489

  Fly   993 AIEFPRNI----TRNASNLIKKLCRDN---PAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLE 1050
            .|...:.|    ..|...:||||.:.|   |::....|:    .:|::.|  ..:...|....:|
Human   490 LIRIRKEIFYELIDNDDEMIKKLLKLNIAFPSDEDMCQK----FLQQNSW--NIFRKDLLQLLVE 548

  Fly  1051 P-------PIKPAVKSV------------VDTTNFDDYP----PDPEGPP 1077
            |       |.:|..:.:            ::.|....||    |....||
Human   549 PCQSQLFTPNRPKKREIYNPKSVVLDLCSINKTTKPRYPIFMAPQKYLPP 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736 32/126 (25%)
CAP_ED 638..754 CDD:237999 31/121 (26%)
S_TKc 778..1036 CDD:214567 46/286 (16%)
STKc_cGK 783..1043 CDD:270724 46/288 (16%)
CNBD2XP_011526892.1 Crp 151..>282 CDD:223736 33/133 (25%)
CAP_ED 163..259 CDD:237999 27/98 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.