DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eif5a and eEF5

DIOPT Version :9

Sequence 1:NP_001004855.1 Gene:eif5a / 448142 XenbaseID:XB-GENE-998075 Length:154 Species:Xenopus tropicalis
Sequence 2:NP_611878.1 Gene:eEF5 / 37846 FlyBaseID:FBgn0285952 Length:159 Species:Drosophila melanogaster


Alignment Length:155 Identity:105/155 - (67%)
Similarity:132/155 - (85%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


 Frog     1 MAD-DIDFTSGDAGASSTFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIF 64
            ||: |..|.:.|:|||:|:|||||||||||||:||.||||||||||||||||||||||:||||||
  Fly     1 MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMVGIDIF 65

 Frog    65 TGKKYEDICPSTHNMDVPNIKRCDYQLIGI-NDNYLSLLSDSGDVREDLKMPEGDLGREILMKHD 128
            :.|||||||||||||||||:||.|.|||.| :|::|:|:::|||:|||||:|||:||.::.:..|
  Fly    66 SNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGELGEQLRLDFD 130

 Frog   129 GGEEILVTVLTAMNEECAVALKAMT 153
            .|:::|.|||.|..|||.:|:|..|
  Fly   131 SGKDLLCTVLKACGEECVIAIKTNT 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eif5aNP_001004855.1 PLN03107 1..150 CDD:357685 103/150 (69%)
eEF5NP_611878.1 PLN03107 1..152 CDD:215580 103/150 (69%)
eIF-5a 84..152 CDD:279611 35/67 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4554
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I3644
OMA 1 1.010 - - QHG53968
OrthoDB 1 1.010 - - D1370513at2759
OrthoFinder 1 1.000 - - FOG0001335
OrthoInspector 1 1.000 - - oto104855
Panther 1 1.100 - - LDO PTHR11673
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2157
SonicParanoid 1 1.000 - - X827
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.