| Sequence 1: | NP_001261188.1 | Gene: | E(bx) / 44811 | FlyBaseID: | FBgn0000541 | Length: | 2761 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_085150.1 | Gene: | KDM7A / 80853 | HGNCID: | 22224 | Length: | 941 | Species: | Homo sapiens |
| Alignment Length: | 239 | Identity: | 66/239 - (27%) |
|---|---|---|---|
| Similarity: | 90/239 - (37%) | Gaps: | 86/239 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2588 LYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPEC----------QRKN--- 2639
Fly 2640 ------DANAANMKKLTSNDVEELKN---------LIK-------QMQLHKSAW--PFMEP---- 2676
Fly 2677 ---------------------------VDPKEAPD-------YYKVIKEPMDLKRME-IKLESNT 2706
Fly 2707 YTKLSEF--IGDMTKIFDNCRYYNPKESSFYKCAEALESYFVQK 2748 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| E(bx) | NP_001261188.1 | DDT | 190..245 | CDD:280886 | |
| WHIM1 | 288..337 | CDD:292246 | |||
| PHD1_BPTF | 341..383 | CDD:277034 | |||
| BAH | 361..>438 | CDD:295389 | |||
| TNG2 | <2423..2638 | CDD:227367 | 28/59 (47%) | ||
| PHD_SF | 2533..2579 | CDD:304600 | |||
| PHD2_3_BPTF | 2589..2635 | CDD:277035 | 27/45 (60%) | ||
| Bromo_gcn5_like | 2653..2752 | CDD:99941 | 34/155 (22%) | ||
| KDM7A | NP_085150.1 | PHD_KDM7 | 39..88 | CDD:277110 | 28/48 (58%) |
| Linker | 97..114 | 3/16 (19%) | |||
| JmjC | 234..297 | CDD:214721 | 14/42 (33%) | ||
| cupin_like | 269..369 | CDD:304367 | 66/239 (28%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 597..633 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 677..700 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 819..921 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1632 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||