DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(bx) and kdm7a

DIOPT Version :9

Sequence 1:NP_001261188.1 Gene:E(bx) / 44811 FlyBaseID:FBgn0000541 Length:2761 Species:Drosophila melanogaster
Sequence 2:NP_001072664.1 Gene:kdm7a / 780121 XenbaseID:XB-GENE-5900920 Length:922 Species:Xenopus tropicalis


Alignment Length:242 Identity:58/242 - (23%)
Similarity:92/242 - (38%) Gaps:92/242 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  2588 LYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQ----------RKN--- 2639
            :||.||||||.|:|.|.||.|:||||..||.:.:.:|..||.|.||.|:          |:|   
 Frog     7 VYCVCRQPYDVSRFMIECDICKDWFHSSCVKVEEHQAADIDLYHCPNCEVLHGPSQLKKRRNWHR 71

  Fly  2640 ------DANAANMKKLTSNDVEELK----------------NLIKQMQLHKSAW--PFMEP---- 2676
                  |.....::..|...:::|:                :.:.|..|.|..:  |.|.|    
 Frog    72 HDYTEPDDGTKPVQAGTRTFIQQLQARSFPSADDLLLKMNGSQLTQRYLEKQGFNLPIMVPRLDD 136

  Fly  2677 VDPKEAPDYYKVIKEPMDLKR----------MEIKLESNTYTKLSEFI----------------- 2714
            :..:..|..:.|    ||::|          :::..::::..||..|:                 
 Frog   137 LGLRLPPPTFSV----MDVERYVGGEKIIDVIDVARQADSKMKLKNFVKYFMNPDRPKVLNVISL 197

  Fly  2715 -------GDMTKIFDNCR------YYNPKESSFYKCAEALESYFVQK 2748
                   .|:.|:.|..:      .|.|.:|.|.|       .||||
 Frog   198 EFSDTKMADLVKVPDISKKLSWVENYWPDDSFFTK-------PFVQK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(bx)NP_001261188.1 DDT 190..245 CDD:280886
WHIM1 288..337 CDD:292246
PHD1_BPTF 341..383 CDD:277034
BAH 361..>438 CDD:295389
TNG2 <2423..2638 CDD:227367 27/59 (46%)
PHD_SF 2533..2579 CDD:304600
PHD2_3_BPTF 2589..2635 CDD:277035 26/45 (58%)
Bromo_gcn5_like 2653..2752 CDD:99941 27/158 (17%)
kdm7aNP_001072664.1 PHD_KDM7 8..57 CDD:277110 27/48 (56%)
JmjC 203..266 CDD:214721 12/42 (29%)
cupin_like 238..338 CDD:304367 58/242 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..490
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..607
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..711
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 754..773
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 872..902
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.