| Sequence 1: | NP_001261188.1 | Gene: | E(bx) / 44811 | FlyBaseID: | FBgn0000541 | Length: | 2761 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001365773.1 | Gene: | Cxxc1 / 74322 | MGIID: | 1921572 | Length: | 664 | Species: | Mus musculus |
| Alignment Length: | 256 | Identity: | 59/256 - (23%) |
|---|---|---|---|
| Similarity: | 88/256 - (34%) | Gaps: | 93/256 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2488 NASPDEQSENERSGEPNLDFKRTEVQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLC 2552
Fly 2553 SNWFHGDCVSITEEASKKLSEFICIDCKR---ARETQQLYCSCR----------QPYDE--SQFY 2602
Fly 2603 ICCDKCQDWFHGRCVGI-------------------------------------LQSEAEFIDEY 2630
Fly 2631 VCPECQRKNDAN----AANMKKLTSNDVEELKNLIKQMQLH-KSAWPF----MEPVDPKEA 2682 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| E(bx) | NP_001261188.1 | DDT | 190..245 | CDD:280886 | |
| WHIM1 | 288..337 | CDD:292246 | |||
| PHD1_BPTF | 341..383 | CDD:277034 | |||
| BAH | 361..>438 | CDD:295389 | |||
| TNG2 | <2423..2638 | CDD:227367 | 45/201 (22%) | ||
| PHD_SF | 2533..2579 | CDD:304600 | 24/45 (53%) | ||
| PHD2_3_BPTF | 2589..2635 | CDD:277035 | 11/94 (12%) | ||
| Bromo_gcn5_like | 2653..2752 | CDD:99941 | 9/35 (26%) | ||
| Cxxc1 | NP_001365773.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 2/7 (29%) | |
| PHD_Cfp1 | 28..73 | CDD:277028 | 24/45 (53%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 91..166 | 6/74 (8%) | |||
| zf-CXXC | 166..212 | CDD:366873 | 10/47 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 223..287 | 5/13 (38%) | |||
| zf-CpG_bind_C | 410..644 | CDD:403474 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1632 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||