DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(bx) and tbrd-1

DIOPT Version :9

Sequence 1:NP_001261188.1 Gene:E(bx) / 44811 FlyBaseID:FBgn0000541 Length:2761 Species:Drosophila melanogaster
Sequence 2:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster


Alignment Length:103 Identity:34/103 - (33%)
Similarity:58/103 - (56%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  2651 SNDVEELKNLIKQMQLHKSAWPFMEPVDPKE--APDYYKVIKEPMDLKRMEIKLESNTYTKLSEF 2713
            :|.:||||:::..:..::.::.|..|||...  .|||:.|:|.||||..:..:|.:..|.:.||.
  Fly    41 TNILEELKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEA 105

  Fly  2714 IGDMTKIFDNCRYYNPKESSFYKCAEALESYFVQKIKN 2751
            :.|...|||||..||.:.|..|:..:.|...|..::::
  Fly   106 LEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAFYMRMES 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(bx)NP_001261188.1 DDT 190..245 CDD:280886
WHIM1 288..337 CDD:292246
PHD1_BPTF 341..383 CDD:277034
BAH 361..>438 CDD:295389
TNG2 <2423..2638 CDD:227367
PHD_SF 2533..2579 CDD:304600
PHD2_3_BPTF 2589..2635 CDD:277035
Bromo_gcn5_like 2653..2752 CDD:99941 33/101 (33%)
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 34/101 (34%)
Bromodomain 328..423 CDD:413371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.