Sequence 1: | NP_001261188.1 | Gene: | E(bx) / 44811 | FlyBaseID: | FBgn0000541 | Length: | 2761 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285579.1 | Gene: | CG3347 / 33538 | FlyBaseID: | FBgn0031513 | Length: | 538 | Species: | Drosophila melanogaster |
Alignment Length: | 251 | Identity: | 57/251 - (22%) |
---|---|---|---|
Similarity: | 86/251 - (34%) | Gaps: | 76/251 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 2582 ARETQQLYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDANAANM 2646
Fly 2647 KKLTS--------------------NDVEELKNL-------------IKQMQLHKSAW------- 2671
Fly 2672 ---PFMEPVDPKEAPDYYKVIKEPM-DLKRMEIK-------------------LESNTYTKLSEF 2713
Fly 2714 IGDMTKIFDNCRYYNPKESS----------FYKCAEALESYFVQKIKNFR--ENVF 2757 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(bx) | NP_001261188.1 | DDT | 190..245 | CDD:280886 | |
WHIM1 | 288..337 | CDD:292246 | |||
PHD1_BPTF | 341..383 | CDD:277034 | |||
BAH | 361..>438 | CDD:295389 | |||
TNG2 | <2423..2638 | CDD:227367 | 24/55 (44%) | ||
PHD_SF | 2533..2579 | CDD:304600 | |||
PHD2_3_BPTF | 2589..2635 | CDD:277035 | 21/45 (47%) | ||
Bromo_gcn5_like | 2653..2752 | CDD:99941 | 22/151 (15%) | ||
CG3347 | NP_001285579.1 | PHD_SF | 23..68 | CDD:304600 | 21/45 (47%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1632 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |