DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(bx) and CG3347

DIOPT Version :9

Sequence 1:NP_001261188.1 Gene:E(bx) / 44811 FlyBaseID:FBgn0000541 Length:2761 Species:Drosophila melanogaster
Sequence 2:NP_001285579.1 Gene:CG3347 / 33538 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster


Alignment Length:251 Identity:57/251 - (22%)
Similarity:86/251 - (34%) Gaps:76/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  2582 ARETQQLYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDANAANM 2646
            |..::.:||.|||.:... |.||||.|.:||||.|:|:..:..|..|.|.|.||.|||.......
  Fly    16 AVSSKDVYCICRQSHING-FMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTY 79

  Fly  2647 KKLTS--------------------NDVEELKNL-------------IKQMQLHKSAW------- 2671
            ||..|                    ...:..||.             ::|....:|.:       
  Fly    80 KKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSE 144

  Fly  2672 ---PFMEPVDPKEAPDYYKVIKEPM-DLKRMEIK-------------------LESNTYTKLSEF 2713
               |..:....::|.:|....:||. |.::::.|                   .:.....||.|.
  Fly   145 VPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFES 209

  Fly  2714 IGDMTKIFDNCRYYNPKESS----------FYKCAEALESYFVQKIKNFR--ENVF 2757
            .|....:|.:...|.|.|:|          ..:.|.:...|...:..||.  .|||
  Fly   210 KGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTAITNVF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(bx)NP_001261188.1 DDT 190..245 CDD:280886
WHIM1 288..337 CDD:292246
PHD1_BPTF 341..383 CDD:277034
BAH 361..>438 CDD:295389
TNG2 <2423..2638 CDD:227367 24/55 (44%)
PHD_SF 2533..2579 CDD:304600
PHD2_3_BPTF 2589..2635 CDD:277035 21/45 (47%)
Bromo_gcn5_like 2653..2752 CDD:99941 22/151 (15%)
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 21/45 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1632
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.