| Sequence 1: | NP_001261188.1 | Gene: | E(bx) / 44811 | FlyBaseID: | FBgn0000541 | Length: | 2761 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001095124.1 | Gene: | CXXC1 / 30827 | HGNCID: | 24343 | Length: | 660 | Species: | Homo sapiens |
| Alignment Length: | 255 | Identity: | 57/255 - (22%) |
|---|---|---|---|
| Similarity: | 89/255 - (34%) | Gaps: | 88/255 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2487 SNASPDEQSENERSGEPNLDFKRTEVQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDL 2551
Fly 2552 CSNWFHGDCVSITEEASKKLSEFICIDC-------------KRARETQQLYCSCRQPYDE----- 2598
Fly 2599 --------------------------------SQFYICCDKCQDWFHGRCVGILQSEAEFIDEYV 2631
Fly 2632 CPECQRKNDAN----AANMKKLTSNDVEELKNLIKQMQLH-KSAWPF----MEPVDPKEA 2682 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| E(bx) | NP_001261188.1 | DDT | 190..245 | CDD:280886 | |
| WHIM1 | 288..337 | CDD:292246 | |||
| PHD1_BPTF | 341..383 | CDD:277034 | |||
| BAH | 361..>438 | CDD:295389 | |||
| TNG2 | <2423..2638 | CDD:227367 | 44/200 (22%) | ||
| PHD_SF | 2533..2579 | CDD:304600 | 24/45 (53%) | ||
| PHD2_3_BPTF | 2589..2635 | CDD:277035 | 9/82 (11%) | ||
| Bromo_gcn5_like | 2653..2752 | CDD:99941 | 8/35 (23%) | ||
| CXXC1 | NP_001095124.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 4/28 (14%) | |
| PHD_Cfp1 | 28..73 | CDD:277028 | 24/45 (53%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 84..162 | 9/79 (11%) | |||
| zf-CXXC | 162..208 | CDD:366873 | 10/47 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..287 | 4/13 (31%) | |||
| zf-CpG_bind_C | 406..640 | CDD:403474 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1632 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||