DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(bx) and Dido1

DIOPT Version :9

Sequence 1:NP_001261188.1 Gene:E(bx) / 44811 FlyBaseID:FBgn0000541 Length:2761 Species:Drosophila melanogaster
Sequence 2:NP_780760.2 Gene:Dido1 / 23856 MGIID:1344352 Length:2256 Species:Mus musculus


Alignment Length:350 Identity:79/350 - (22%)
Similarity:131/350 - (37%) Gaps:122/350 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  2305 LEGSEHDEPTNLAGLDISETDLENKQNESFVVTRGYIQKSISNALKQGNLSPELEEKLVCMQKQQ 2369
            ||.|  .|||:....|: ||..|.....|..:..|.:..|:      |...|...||....::::
Mouse    91 LEDS--SEPTSSTVTDV-ETASEGSVESSSEIRSGPVSDSL------GKEHPASSEKAKGGEEEE 146

  Fly  2370 ENANSTNEWETCSRGSVNEEALTPSRQTDDTEWKIRTSLRRPNAMTTSSQFNRILKKNRSKNDEV 2434
            :.::|.::..|...   .:..|...|:.:..|..:|.|.            ||:.||.|  .::.
Mouse   147 DTSDSDSDGLTLKE---LQNRLRRKREQEPVERSLRGSQ------------NRLRKKRR--EEDS 194

  Fly  2435 AELGEQKQSQLERHKELLKKNILRKRSLLERNLQSEIHEDVKTKVQRHVRPLSNASPDEQSENER 2499
            ||.|..:....|:.:.|.|:                             .|.::..|..|||.: 
Mouse   195 AETGSVQIGSAEQDRPLCKQ-----------------------------EPEASQGPVSQSETD- 229

  Fly  2500 SGEPNLDFKRTE---VQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLCSNWFHGDCV 2561
            ..|..|:.|.|:   .:|||. ||:||.                                     
Mouse   230 DIENQLEGKATQGNTEENPRE-AGKPKP------------------------------------- 256

  Fly  2562 SITEEASKKLSEFICIDCKRARETQQLYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEF 2626
                            :|: ..:...|||.||||:: ::|.||||:|::||||.||||.::....
Mouse   257 ----------------ECE-VYDPNALYCICRQPHN-NRFMICCDRCEEWFHGDCVGISEARGRL 303

  Fly  2627 I----DEYVCPEC---QRKNDANAA 2644
            :    ::|:||.|   |.:::.|.:
Mouse   304 LERNGEDYICPNCTILQVQDETNGS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(bx)NP_001261188.1 DDT 190..245 CDD:280886
WHIM1 288..337 CDD:292246
PHD1_BPTF 341..383 CDD:277034
BAH 361..>438 CDD:295389
TNG2 <2423..2638 CDD:227367 52/224 (23%)
PHD_SF 2533..2579 CDD:304600 0/45 (0%)
PHD2_3_BPTF 2589..2635 CDD:277035 23/49 (47%)
Bromo_gcn5_like 2653..2752 CDD:99941
Dido1NP_780760.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..256 50/221 (23%)
TNG2 <157..299 CDD:227367 55/244 (23%)
Nuclear localization signal. /evidence=ECO:0000255 162..170 1/7 (14%)
Nuclear localization signal. /evidence=ECO:0000255 182..190 4/19 (21%)
PHD_DIDO1_like 263..316 CDD:277109 24/53 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 481..535
PHA03247 <483..663 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 598..624
PRK14954 <600..>665 CDD:184918
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..668
TFS2M 669..770 CDD:128786
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..822
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 856..970
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1011..1039
SPOC 1045..1190 CDD:369497
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1197..1218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1245..1288
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1320..1347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1362..1421
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1509..1609
PHA03247 <1571..2083 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1630..2256
SF-CC1 2142..>2180 CDD:273721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.