DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and CDC5

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_013714.1 Gene:CDC5 / 855013 SGDID:S000004603 Length:705 Species:Saccharomyces cerevisiae


Alignment Length:316 Identity:78/316 - (24%)
Similarity:137/316 - (43%) Gaps:80/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELM-DANLCQVIQMD--LDHDRMS 127
            |:...|.::.|.::|.||:..::.|      |:..:||:::|:. :.:|.::::..  |....:.
Yeast   124 KKLLSEIQIHKSMSHPNIVQFIDCF------EDDSNVYILLEICPNGSLMELLKRRKVLTEPEVR 182

  Fly   128 YLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGT------TFMMTPYVVT 186
            :...|:...||::||..:||||||..||...::..|||.|||||.....      |...||    
Yeast   183 FFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTP---- 243

  Fly   187 RYYRAPEVILG--MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQR 249
             .|.||||::|  .|::..|||||:|.::..::.|                       .|.|..|
Yeast   244 -NYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIG-----------------------KPPFQAR 284

  Fly   250 LQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEA 314
            ...|:...::.|             |..||.|     :..:.:.:.|:..:|.:||.:|.|:.|.
Yeast   285 DVNTIYERIKCR-------------DFSFPRD-----KPISDEGKILIRDILSLDPIERPSLTEI 331

  Fly   315 LKHEYINVWYDA-------EEVDAPAPE----PYDHSVDEREHTVEQWKELIYEEV 359
            :.:    ||:..       ..|.:.||.    |.:.|:...:..:|  |.|:.|.:
Yeast   332 MDY----VWFRGTFPPSIPSTVMSEAPNFEDIPEEQSLVNFKDCME--KSLLLESM 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 78/314 (25%)
CDC5NP_013714.1 STKc_PLK 80..337 CDD:271001 68/268 (25%)
POLO_box_1 510..601 CDD:240561
POLO_box_2 613..698 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.