DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and MEK1

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:77/352 - (21%)
Similarity:133/352 - (37%) Gaps:102/352 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 INLRPIGSGAQGIVCAAYDTITQ--------QNVAIKKLS-RPFQNVTHAKRAYREFKLMKLVNH 80
            |..|.:|:|..|.|...:::..:        :|.|:|.:. :|       .:..:|.:::..::|
Yeast   163 ITNRIVGNGTFGHVLITHNSKERDEDVCYHPENYAVKIIKLKP-------NKFDKEARILLRLDH 220

  Fly    81 KNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYL---------------- 129
            .|||.:.:.|..:.|     .:|:..:|:...           |..|||                
Yeast   221 PNIIKVYHTFCDRNN-----HLYIFQDLIPGG-----------DLFSYLAKGDCLTSMSETESLL 269

  Fly   130 -LYQMLCGIKHLHSAGIIHRDLKPSNIVV--KADCTLKIL-DFGLARTAGTT-FMMTPYVVTRYY 189
             ::|:|..:.:||...|:|||||..||::  ...||..:| |||:|:...:. ..|...|.|..|
Yeast   270 IVFQILQALNYLHDQDIVHRDLKLDNILLCTPEPCTRIVLADFGIAKDLNSNKERMHTVVGTPEY 334

  Fly   190 RAPEV-----------------ILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTD---------- 227
            .||||                 :...||....|:||:|.|...|:.|...|.|..          
Yeast   335 CAPEVGFRANRKAYQSFSRAATLEQRGYDSKCDLWSLGVITHIMLTGISPFYGDGSERSIIQNAK 399

  Fly   228 ------HIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGY----------SFDRLFPDG 276
                  .:.||:.:.:.    :.||::.|..|  :.|:......|.          ..:||:...
Yeast   400 IGKLNFKLKQWDIVSDN----AKSFVKDLLQT--DVVKRLNSKQGLKHIWIAKHLSQLERLYYKK 458

  Fly   277 LFPNDNNQNSRRKASDARNLLSKMLVI 303
            :..|:.........||.:..|.|.::|
Yeast   459 ILCNNEGPKLESINSDWKRKLPKSVII 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 77/352 (22%)
MEK1NP_014996.3 FHA 28..122 CDD:238017
STKc_CAMK 160..443 CDD:270687 69/308 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.