DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and CDC28

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_009718.3 Gene:CDC28 / 852457 SGDID:S000000364 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:104/322 - (32%)
Similarity:145/322 - (45%) Gaps:57/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRYINLRPIGSGAQGIVCAAYDTIT---QQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNI 83
            :.|..|..:|.|..|:|..|.|...   |:.||:||:....::......|.||..|:|.:...||
Yeast     6 ANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNI 70

  Fly    84 IGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ-----MDLDHDRMSYLLYQMLCGIKHLHSA 143
            :.|.:...     .:...:|||.|.:|.:|.:.::     ..|..|.:...:.|:..||.:.||.
Yeast    71 VRLYDIVH-----SDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSH 130

  Fly   144 GIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTF-MMTPYVVTRYYRAPEVIL-GMGYTENVDI 206
            .|:||||||.|:::..|..||:.||||||..|... ..|..:||.:||||||:| |..|:..||.
Yeast   131 RILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDT 195

  Fly   207 WSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPS--------------PSFMQRLQPTVRNY 257
            ||:|||..||.....:|.|...|||..||...||||:              |||.|..:..:...
Yeast   196 WSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRKDLSQV 260

  Fly   258 VENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEY 319
            |.:           |.|.|:                 :||.|:|..||..|||...|..|.|
Yeast   261 VPS-----------LDPRGI-----------------DLLDKLLAYDPINRISARRAAIHPY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 104/321 (32%)
CDC28NP_009718.3 STKc_CDK1_CdkB_like 8..295 CDD:270829 104/320 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.