DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and AT1G67580

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001154456.1 Gene:AT1G67580 / 843079 AraportID:AT1G67580 Length:752 Species:Arabidopsis thaliana


Alignment Length:397 Identity:121/397 - (30%)
Similarity:185/397 - (46%) Gaps:75/397 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QHYTVEVGDTNFTIHSRYIN-------------LRPIGSGAQGIVCAAYDTITQQNVAIKKLSRP 58
            :|.|.|...|..    |.||             |..|..|..|:|..|.|..|.:.||:||:...
plant   380 RHETPEPASTPL----RSINMLQGCRSVDEFERLNKIDEGTYGVVYRAKDKKTGEIVALKKVKME 440

  Fly    59 FQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDAN---LCQVIQMD 120
            .:.......:.||..::...:|.:|:.:......    .....:::|||.|:.:   |.:.::..
plant   441 KEREGFPLTSLREINILLSFHHPSIVDVKEVVVG----SSLDSIFMVMEYMEHDLKALMETMKQR 501

  Fly   121 LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPY-- 183
            .....:..|:.|:|.|:|:||...::|||||.||:::.....|||.||||||..|:.  :.||  
plant   502 FSQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKICDFGLARQYGSP--LKPYTH 564

  Fly   184 -VVTRYYRAPEVILG-MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSF 246
             |||.:|||||::|| ..|:..:|:||:||||.|::....||.|....||.:||...||||:.|.
plant   565 LVVTLWYRAPELLLGAKQYSTAIDMWSLGCIMAELLMKAPLFNGKTEFDQLDKIFRILGTPNESI 629

  Fly   247 ---MQRLQPTVRNYVEN-----RPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDAR-NLLSKMLV 302
               ..:|.....|:|::     |.::...||               ......|||. :||:|:|.
plant   630 WPGFSKLPGVKVNFVKHQYNLLRKKFPATSF---------------TGAPVLSDAGFDLLNKLLT 679

  Fly   303 IDPEQRISVDEALKHEYINVWYDAEEVDAPAPE------PYDHSVDEREHTV---------EQWK 352
            .|||:||:|:|||||:    |:  .||..|..:      |..|:.|.|...:         ::.|
plant   680 YDPERRITVNEALKHD----WF--REVPLPKSKDFMPTFPAQHAQDRRGRRMVKSPDPLEEQRRK 738

  Fly   353 ELIYEEV 359
            ||...|:
plant   739 ELTQTEL 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 116/379 (31%)
AT1G67580NP_001154456.1 STKc_CDC2L1 400..697 CDD:173741 102/321 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.