DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and MPK11

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001117210.1 Gene:MPK11 / 839523 AraportID:AT1G01560 Length:369 Species:Arabidopsis thaliana


Alignment Length:350 Identity:150/350 - (42%)
Similarity:215/350 - (61%) Gaps:20/350 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FTIHSRYI-NLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHK 81
            |.:..:|: .|||||.||.||||||:::.|.:.|||||:...|.|:..|||..||.||:|.::|.
plant    33 FEVSKKYVPPLRPIGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHD 97

  Fly    82 NIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD--LDHDRMSYLLYQMLCGIKHLHSAG 144
            |:|.:::...|.:. :.|.||::|.||||.:|..:|:.:  |..|...:.|||:|.|:|::|||.
plant    98 NVIAIIDIIRPPQP-DNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSAN 161

  Fly   145 IIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMG-YTENVDIWS 208
            ::||||||||:::.|:|.|||.|||||||...|..||.|||||:|||||::|... ||..:||||
plant   162 VLHRDLKPSNLLLNANCDLKIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWS 226

  Fly   209 VGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQ-PTVRNYVENRPRYTGYSFDRL 272
            ||||:||::....||||.|::.|...|.|.:|:|..|.:..|: ...|.||...|:|...:|...
plant   227 VGCILGEIMTREPLFPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAAR 291

  Fly   273 FPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPY 337
            ||:             .:.:|.:||.||||.||.:||:|||||.|.|:...::..| :.....|:
plant   292 FPN-------------MSVNAVDLLQKMLVFDPNRRITVDEALCHPYLAPLHEYNE-EPVCVRPF 342

  Fly   338 DHSVDEREHTVEQWKELIYEEVMDY 362
            ....::...|.|..|||||.|.:.:
plant   343 HFDFEQPSLTEENIKELIYRESVKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 148/340 (44%)
MPK11NP_001117210.1 STKc_TEY_MAPK 33..369 CDD:143363 150/349 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.