DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and ATMPK13

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001030990.1 Gene:ATMPK13 / 837303 AraportID:AT1G07880 Length:363 Species:Arabidopsis thaliana


Alignment Length:352 Identity:151/352 - (42%)
Similarity:212/352 - (60%) Gaps:22/352 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FTIHSRYI-NLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHK 81
            |.:.|:|| .:.|||.||.||||.|.::.|.:.|||||::..|.|...|||..||.||:..::|.
plant    26 FELSSKYIPPIEPIGRGAYGIVCCATNSETNEEVAIKKIANAFDNRVDAKRTLREIKLLSHMDHD 90

  Fly    82 NIIGLLNAF-TPQRNLEEFQDVYLVMELMDANLCQVIQ--MDLDHDRMSYLLYQMLCGIKHLHSA 143
            |:|.:.:.. .|::  |.|:|||:|.||||.:|.|:|:  ..|..|...|.|||:|.|:|::|||
plant    91 NVIKIKDIIELPEK--ERFEDVYIVYELMDTDLHQIIRSTQTLTDDHCQYFLYQILRGLKYIHSA 153

  Fly   144 GIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMG-YTENVDIW 207
            .::||||||||:|:..:|.|||.|||||||:..|.:||.|||||:|||||::|... ||..:|||
plant   154 NVLHRDLKPSNLVLNTNCDLKICDFGLARTSNETEIMTEYVVTRWYRAPELLLNSSEYTGAIDIW 218

  Fly   208 SVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQ-PTVRNYVENRPRYTGYSFDR 271
            |||||..|::|...||||.|::.|...|.|.||:|..|.:..|: ...|.||:..|.....||..
plant   219 SVGCIFMEILRRETLFPGKDYVQQLKLITELLGSPDDSDLDFLRSDNARKYVKQLPHVQKQSFRE 283

  Fly   272 LFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEP 336
            .||: :.|.            |.:|..||||.||.:||:||||||..|:...::..| :...|.|
plant   284 KFPN-ISPM------------ALDLAEKMLVFDPSKRITVDEALKQPYLASLHEINE-EPTCPTP 334

  Fly   337 YDHSVDEREHTVEQWKELIYEEVMDYE 363
            :....:|.....:..|||::.|.:.::
plant   335 FSFDFEETALDEQDIKELVWRESLHFK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 148/341 (43%)
ATMPK13NP_001030990.1 STKc_TEY_MAPK 26..362 CDD:143363 151/352 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.