DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and MPK4

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_192046.1 Gene:MPK4 / 828151 AraportID:AT4G01370 Length:376 Species:Arabidopsis thaliana


Alignment Length:355 Identity:153/355 - (43%)
Similarity:217/355 - (61%) Gaps:20/355 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FTIHSRYI-NLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHK 81
            |.:..:|: .|||||.||.||||||.::.|.:.|||||:...|.|:..|||..||.||:|.::|:
plant    36 FEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHE 100

  Fly    82 NIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD--LDHDRMSYLLYQMLCGIKHLHSAG 144
            |:|.:.:...|.:. |.|.|||:|.||||.:|.|:|:.:  |..|...:.|||:|.|:|::|||.
plant   101 NVIAVKDIIKPPQR-ENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSAN 164

  Fly   145 IIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMG-YTENVDIWS 208
            ::||||||||:::.|:|.||:.|||||||...|..||.|||||:|||||::|... ||..:||||
plant   165 VLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWS 229

  Fly   209 VGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQ-PTVRNYVENRPRYTGYSFDRL 272
            ||||:||.:....||||.|::.|...|.|.:|:|..|.:..|: ...|.||...|:|...:|...
plant   230 VGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAAR 294

  Fly   273 FPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPY 337
            ||:             .::.|.:||.||||.||.:||:|||||.|.|:...:|..| :.....|:
plant   295 FPN-------------MSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINE-EPVCVRPF 345

  Fly   338 DHSVDEREHTVEQWKELIYEEVMDYEAHNT 367
            :...::...|.|..|||||.|.:.:...::
plant   346 NFDFEQPTLTEENIKELIYRETVKFNPQDS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 151/340 (44%)
MPK4NP_192046.1 STKc_TEY_MAPK 36..372 CDD:143363 153/350 (44%)
S_TKc 46..329 CDD:214567 139/296 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.