DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and MHK

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001031622.1 Gene:MHK / 826915 AraportID:AT4G13020 Length:444 Species:Arabidopsis thaliana


Alignment Length:325 Identity:106/325 - (32%)
Similarity:154/325 - (47%) Gaps:67/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ------NVTHAKRAYREFKLMKLVNHK 81
            ||..|..:|.|..|.|..|.:..|.:.||:||:.|.|.      |:       ||.|.::.:||.
plant    11 RYKILEELGDGTCGSVYKAVNLETYEVVAVKKMKRKFYYWEECVNL-------REVKALRKLNHP 68

  Fly    82 NIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVI---QMDLDHDRMSYLLYQMLCGIKHLHSA 143
            :||.|      :..:.|..:::.:.|.||.||..::   :.......:...:.|||.|:.|:|..
plant    69 HIIKL------KEIVREHNELFFIFECMDHNLYHIMKERERPFSEGEIRSFMSQMLQGLAHMHKN 127

  Fly   144 GIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMG-YTENVDIW 207
            |..||||||.|::| .:..|||.||||||...:....|.||.||:||||||:|... ||..||:|
plant   128 GYFHRDLKPENLLV-TNNILKIADFGLAREVASMPPYTEYVSTRWYRAPEVLLQSSLYTPAVDMW 191

  Fly   208 SVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGY----S 268
            :||.|:.|:.....||||...|||..||...||                    :|.:|.:    |
plant   192 AVGAILAELYALTPLFPGESEIDQLYKICCVLG--------------------KPDWTTFPEAKS 236

  Fly   269 FDRL-------FPD----GLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINV 322
            ..|:       ||.    .|.||        .|.:|.:|::::...||.:|.:.||||.|.:.::
plant   237 ISRIMSISHTEFPQTRIADLLPN--------AAPEAIDLINRLCSWDPLKRPTADEALNHPFFSM 293

  Fly   323  322
            plant   294  293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 106/325 (33%)
MHKNP_001031622.1 STKc_MAK_like 12..291 CDD:270824 105/320 (33%)
S_TKc 12..291 CDD:214567 105/320 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.