DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and AT4G10010

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001328367.1 Gene:AT4G10010 / 826592 AraportID:AT4G10010 Length:649 Species:Arabidopsis thaliana


Alignment Length:326 Identity:93/326 - (28%)
Similarity:156/326 - (47%) Gaps:42/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFT 91
            |..||.|....|..|.|..|.:.||:||:.....:....:...||..:::.::|.|::.|....|
plant   159 LDKIGQGTYSSVYRARDLETGKMVAMKKVRFVNMDPESVRFMAREINILRKLDHPNVMKLECLVT 223

  Fly    92 PQRNLEEFQDVYLVMELMDANLCQVI---QMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPS 153
            .:.:    ..:|||.|.|:.:|..:.   .:.....::...:.|:|.|::|.||.||:|||:|..
plant   224 SKLS----GSLYLVFEYMEHDLSGLALRPGVKFTESQIKCYMKQLLSGLEHCHSRGILHRDIKGP 284

  Fly   154 NIVVKADCTLKILDFGLART--AGTTFMMTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIMGE 215
            |::|..|..|||.|||||..  ......:|..|||.:|||||::|| ..|...:|:||||||:.|
plant   285 NLLVNNDGVLKIGDFGLANIYHPEQDQPLTSRVVTLWYRAPELLLGATEYGPGIDLWSVGCILTE 349

  Fly   216 MIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQ-PTVRNYVENRP--RYTGYSFDRLFPDGL 277
            :..|..:.||...::|.:||.:..|:||..:.|:.: |...::...:|  |....:|..|.|..|
plant   350 LFLGKPIMPGRTEVEQMHKIFKFCGSPSDDYWQKTKLPLATSFKPQQPYKRVLLETFKNLPPSAL 414

  Fly   278 FPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINV------------WYDAEEVD 330
                             .|:.|:|.::|.:|.:....|..::..:            :..::|:|
plant   415 -----------------ALVDKLLSLEPAKRGTASSTLSSKFFTMEPLPCNVSSLPKYPPSKELD 462

  Fly   331 A 331
            |
plant   463 A 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 93/326 (29%)
AT4G10010NP_001328367.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.