DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and AT3G53640

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_190932.1 Gene:AT3G53640 / 824532 AraportID:AT3G53640 Length:642 Species:Arabidopsis thaliana


Alignment Length:345 Identity:105/345 - (30%)
Similarity:171/345 - (49%) Gaps:47/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQ----QNVAIKKLSRPFQNVTHAKRA 68
            :|:.::|:   .:..||..:...|.|....|..|.||..:    :.||||.:.:   |.|..|..
plant   310 YYSYQLGE---LLDDRYEIMATHGKGVFSTVVRAKDTKPELGEPEEVAIKIIRK---NETMHKAG 368

  Fly    69 YREFKLMKLV------NHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ---MDLDHD 124
            ..|.:::|.:      |..:.:.||:.|..:.:|      .||.|.:..||.:|::   :::...
plant   369 QAEIRILKKLVCSDPENKHHCVRLLSTFEYRNHL------CLVFESLHLNLREVVKKIGVNIGLK 427

  Fly   125 RMSYLLY--QMLCGIKHLHSAGIIHRDLKPSNIVV-KADCTLKILDFGLARTAGTTFMMTPYVVT 186
            .....:|  |:...:|||.:.|::|.|:||.||:: :....||:.|||.|..||.. .:|||:|:
plant   428 LYDVRVYAEQLFISLKHLKNCGVLHCDIKPDNILMNEGRNMLKLCDFGSAMFAGEN-QVTPYLVS 491

  Fly   187 RYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFM---- 247
            |:|||||:|||:.|...:|||||||.:.|:..|.::|||:.:.|.....:|..| |.|..|    
plant   492 RFYRAPEIILGLPYDHPLDIWSVGCCLYELYSGKIMFPGSTNNDMLRLHMELKG-PFPKKMLRKG 555

  Fly   248 ----QRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDA--------RNLLSKM 300
                |.....:..|.......||.:..|:..: :.|.|.....||:..|.        ||||.|:
plant   556 AFIDQHFDKDLCFYATEEDSVTGKTIRRIMVN-VKPKDLGSVIRRRYEDEDPKVLVHFRNLLDKI 619

  Fly   301 LVIDPEQRISVDEALKHEYI 320
            ..:||::|::|.:||.|.:|
plant   620 FTLDPQKRLTVSQALAHPFI 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 103/330 (31%)
AT3G53640NP_190932.1 U79_P34 <75..130 CDD:281109
STKc_PRP4 322..639 CDD:271037 102/328 (31%)
S_TKc 323..639 CDD:214567 101/327 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.