DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and FC1

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001030853.1 Gene:FC1 / 824525 AraportID:AT3G53570 Length:467 Species:Arabidopsis thaliana


Alignment Length:391 Identity:102/391 - (26%)
Similarity:157/391 - (40%) Gaps:92/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREF 72
            ||...|||   |:..||..|..:|.|..|.|...:|...::.||||        |..:...|||.
plant   102 HYVFVVGD---TLTPRYQILSKMGEGTFGQVLECFDNKNKEVVAIK--------VIRSINKYREA 155

  Fly    73 KLMKLVNHKNIIGLLNAFTPQ----------RNLEEFQD-VYLVMELMDANLCQVIQMD----LD 122
            .:::       |.:|...|..          ||..:::: :.:|.|.:..:|...::.:    ..
plant   156 AMIE-------IDVLQRLTRHDVGGSRCVQIRNWFDYRNHICIVFEKLGPSLYDFLRKNSYRSFP 213

  Fly   123 HDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKA---------------------------D 160
            .|.:..|..|:|..:.::|...:||.||||.||::.:                           .
plant   214 IDLVRELGRQLLESVAYMHDLRLIHTDLKPENILLVSSEYIKIPDYKFLSRPTKDGSYFKNLPKS 278

  Fly   161 CTLKILDFGLARTAGTTFMMTP--YVV-TRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVL 222
            ..:|::|||     .|||....  |:| ||:|||||||||:|:....|:||:|||:.|:..|..|
plant   279 SAIKLIDFG-----STTFEHQDHNYIVSTRHYRAPEVILGVGWNYPCDLWSIGCILVELCSGEAL 338

  Fly   223 FPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGL---------- 277
            |...::::....:...||...|..:.|.......|...     |...|  :|:|.          
plant   339 FQTHENLEHLAMMERVLGPLPPHMVLRADRRSEKYFRR-----GAKLD--WPEGATSRDSLKAVW 396

  Fly   278 ----FPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYD 338
                .||...|:....|.|..:||..:|..||.:|....|||.|.:..   .:.|...|...|..
plant   397 KLPRLPNLIMQHVDHSAGDLIDLLQGLLRYDPTERFKAREALNHPFFT---RSREQSIPPFNPNP 458

  Fly   339 H 339
            |
plant   459 H 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 96/376 (26%)
FC1NP_001030853.1 PKc_CLK 102..443 CDD:271036 98/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.