DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and AT3G25840

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_189213.2 Gene:AT3G25840 / 822178 AraportID:AT3G25840 Length:935 Species:Arabidopsis thaliana


Alignment Length:344 Identity:100/344 - (29%)
Similarity:163/344 - (47%) Gaps:46/344 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYD----TITQQNVAIKKLSRPFQNVTHAKRA 68
            :|:.:.|:   .:..||..:...|.|....|..|.|    ....:.||||.:.   .|.|..|..
plant   604 YYSYQFGE---LLDGRYEVIATHGKGVFSTVVRAKDLKAGPAEPEEVAIKIIR---NNETMHKAG 662

  Fly    69 YREFKLMKLV------NHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ-----MDLD 122
            ..|.:::|.:      :.::.:..|::|..:.:|      .||.|.:..||.:|::     :.|.
plant   663 KIEVQILKKLAGADREDRRHCVRFLSSFKYRNHL------CLVFESLHLNLREVLKKFGRNIGLQ 721

  Fly   123 HDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVV-KADCTLKILDFGLARTAGTTFMMTPYVVT 186
            ...:.....|:...:|||.:.|::|.|:||.|::| :....||:.|||.|..||.. .:|||:|:
plant   722 LSAVRAYSKQLFIALKHLKNCGVLHCDIKPDNMLVNEGKNVLKLCDFGNAMFAGKN-EVTPYLVS 785

  Fly   187 RYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFM---- 247
            |:||:||:|||:.|...:|||||||.:.|:..|.|||||..:.|.....:|..| |.|..|    
plant   786 RFYRSPEIILGLTYDHPLDIWSVGCCLYELYSGKVLFPGATNNDMLRLHMELKG-PFPKKMLRKG 849

  Fly   248 ----QRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQ-------NSRRKASDARNLLSKML 301
                |.....:..|.......:|....|:..: :.|.|...       ...:..:..|:||.||.
plant   850 AFIDQHFDHDLNFYATEEDTVSGKLIKRMIVN-VKPKDFGSIIKGYPGEDPKILAHFRDLLDKMF 913

  Fly   302 VIDPEQRISVDEALKHEYI 320
            ::|||:|::|.:||.|.:|
plant   914 ILDPERRLTVSQALAHPFI 932

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 98/329 (30%)
AT3G25840NP_189213.2 PRP38_assoc 186..266 CDD:289628
DUF1777 315..>439 CDD:285811
STKc_PRP4 616..932 CDD:271037 97/327 (30%)
S_TKc 617..932 CDD:214567 96/326 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.