DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and mapk7

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001072332.1 Gene:mapk7 / 779785 XenbaseID:XB-GENE-5881331 Length:925 Species:Xenopus tropicalis


Alignment Length:357 Identity:142/357 - (39%)
Similarity:210/357 - (58%) Gaps:29/357 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVN 79
            |.||.:...|..:..||.||.|:|.:|......|.|||||:...|..||:|||..||.|::|...
 Frog    41 DVNFEVGDEYEIIETIGVGAYGVVSSARRKGCGQRVAIKKIPNAFDVVTNAKRTLRELKILKHFK 105

  Fly    80 HKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ----MDLDHDRMSYLLYQMLCGIKHL 140
            |.|||.:.:...|.....:|:.||:|::||:::|.|:|.    :.|:|.|  |.|||:|.|:|::
 Frog   106 HDNIIAIKDILKPSVPYNDFRSVYVVLDLMESDLHQIIHSSQPLTLEHAR--YFLYQLLRGLKYI 168

  Fly   141 HSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGT-----TFMMTPYVVTRYYRAPEVILGM-G 199
            |||.::||||||||:::..:|.|||.|||:||...|     .:.||.||.||:||.||::|.: .
 Frog   169 HSANVLHRDLKPSNLLINENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRPPELMLSLHE 233

  Fly   200 YTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL-QPTVRNYVENRPR 263
            ||:.:|:||||||..||:....||||.:::.|.:.|:..|||||...::.: ...||.|:::.|.
 Frog   234 YTQAIDMWSVGCIFAEMLGRKPLFPGKNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPS 298

  Fly   264 YTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEE 328
            .....:..|:|          .:.:||.|   ||||||..||..||||.|||:|.:::.::|.: 
 Frog   299 RQPVPWATLYP----------QAGKKALD---LLSKMLRFDPRDRISVAEALRHPFLSKYHDPD- 349

  Fly   329 VDAPAPEP-YDHSVDEREHTVEQWKELIYEEV 359
             |.|...| :|...|::..|.:|.||.|..|:
 Frog   350 -DEPECIPAFDFGFDKKILTKDQIKEAITAEI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 138/347 (40%)
mapk7NP_001072332.1 STKc_ERK5 44..379 CDD:270842 139/351 (40%)
S_TKc 50..342 CDD:214567 127/306 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.